BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30712.Seq (698 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25798| Best HMM Match : FA_desaturase (HMM E-Value=0) 91 6e-19 SB_32486| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_46957| Best HMM Match : fn3 (HMM E-Value=3.8) 30 2.1 SB_3285| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_44095| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_43794| Best HMM Match : zf-B_box (HMM E-Value=6) 29 3.6 SB_14976| Best HMM Match : rve (HMM E-Value=1.3e-38) 29 4.8 SB_37799| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_14824| Best HMM Match : F5_F8_type_C (HMM E-Value=1.5e-17) 28 8.4 SB_5572| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 >SB_25798| Best HMM Match : FA_desaturase (HMM E-Value=0) Length = 268 Score = 91.5 bits (217), Expect = 6e-19 Identities = 36/55 (65%), Positives = 42/55 (76%) Frame = +3 Query: 486 SFTGQSKSTHWVRDHRVHHKYSDTDADPHNASRGFFYSHIGWLFVRXHPEVKKKG 650 S Q+ W RDHRVHHKYS+TDADPHNA RGFF+SH+GWL R HP+V +KG Sbjct: 48 SMAAQNDIFEWSRDHRVHHKYSETDADPHNAKRGFFFSHVGWLMQRKHPDVIRKG 102 Score = 56.4 bits (130), Expect = 2e-08 Identities = 34/99 (34%), Positives = 50/99 (50%), Gaps = 1/99 (1%) Frame = +1 Query: 403 GVTAGAHRLWSHKSYKARLPLQILLMVFLSLANQRAPIGFETIESITSTAIRTQIHITQA 582 GVT GAHRLW+H+++KA+ PL++++M+ S+A Q + + T A Sbjct: 19 GVTIGAHRLWAHRTFKAKWPLRLVIMLMNSMAAQNDIFEWSRDHRVHHKYSETDADPHNA 78 Query: 583 VASFILI*VG-CSSXNTLKLRRKGKLIDLSDLFDXPALM 696 F VG + RKGK IDLSDL+ +M Sbjct: 79 KRGFFFSHVGWLMQRKHPDVIRKGKGIDLSDLYADSVVM 117 >SB_32486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 914 Score = 30.3 bits (65), Expect = 1.6 Identities = 24/78 (30%), Positives = 36/78 (46%), Gaps = 2/78 (2%) Frame = +3 Query: 306 TRYNVLWPISLLYDSEVAFSWIRVPVLCSSNDWRYSWSSQTVVP--QIIQSKITSSNPTN 479 + Y L PIS + D +V S + + D R S T +P I+ K+T+ N Sbjct: 659 SHYTTL-PISGILDPKVRESHYTTLPISGNLDTRVGESHYTALPISGILDPKLTAPNTGL 717 Query: 480 GLSFTGQSKSTHWVRDHR 533 S T S++ + RDHR Sbjct: 718 TYSTTKNSRNEIYFRDHR 735 >SB_46957| Best HMM Match : fn3 (HMM E-Value=3.8) Length = 123 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/44 (29%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +3 Query: 306 TRYNVLWP-ISLLYDSEVAFSWIRVPVLCSSNDWRYSWSSQTVV 434 + Y V W + ++ DSE W +PV+ S +++ W++ TV+ Sbjct: 18 SEYTVQWTTLPVMSDSEYTVQWTTLPVM-SDSEYTVQWTTLTVM 60 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/44 (29%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +3 Query: 306 TRYNVLWP-ISLLYDSEVAFSWIRVPVLCSSNDWRYSWSSQTVV 434 + Y V W + ++ DSE W +PV+ S +++ W++ TV+ Sbjct: 63 SEYTVQWTTLPVMSDSEYTVQWTTLPVM-SDSEYTVQWTTLTVM 105 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/44 (27%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +3 Query: 306 TRYNVLWP-ISLLYDSEVAFSWIRVPVLCSSNDWRYSWSSQTVV 434 + Y V W ++++ DSE W +PV+ S +++ W++ V+ Sbjct: 48 SEYTVQWTTLTVMSDSEYTVQWTTLPVM-SDSEYTVQWTTLPVM 90 >SB_3285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1437 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/44 (29%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +3 Query: 306 TRYNVLWP-ISLLYDSEVAFSWIRVPVLCSSNDWRYSWSSQTVV 434 + YNV W + ++ DSE W +PV+ S +++ W++ V+ Sbjct: 571 SEYNVQWTTLPVMSDSEYTVQWTTLPVM-SDSEYTLQWTTLPVM 613 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/44 (29%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +3 Query: 306 TRYNVLWP-ISLLYDSEVAFSWIRVPVLCSSNDWRYSWSSQTVV 434 + Y V W + ++ DSE W +PV+ S +++ W++ TV+ Sbjct: 661 SEYTVQWTTLPVMSDSEYTVQWTTLPVM-SDSEYTVQWTTLTVM 703 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/44 (27%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +3 Query: 306 TRYNVLWP-ISLLYDSEVAFSWIRVPVLCSSNDWRYSWSSQTVV 434 + Y V W + ++ DSE W +PV+ S +++ W++ V+ Sbjct: 586 SEYTVQWTTLPVMSDSEYTLQWTTLPVM-SDSEYTVQWTTLPVM 628 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/44 (27%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +3 Query: 306 TRYNVLWP-ISLLYDSEVAFSWIRVPVLCSSNDWRYSWSSQTVV 434 + Y V W + ++ DSE W +PV+ S +++ W++ V+ Sbjct: 616 SEYTVQWTTLPVMSDSEYTVQWTTLPVM-SDSEYTVQWTTPPVM 658 >SB_44095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3051 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = -2 Query: 538 WTLWSRTQWVLFDWPVKERPLVGFEEVILLCMICGTTVCELQL 410 W+LWSR+ W WP P + + L ++CG +C L L Sbjct: 1648 WSLWSRSMWPRSLWPRSLWPRSLWRWSLCL-VLCGLGLCCLGL 1689 >SB_43794| Best HMM Match : zf-B_box (HMM E-Value=6) Length = 320 Score = 29.1 bits (62), Expect = 3.6 Identities = 22/93 (23%), Positives = 38/93 (40%), Gaps = 13/93 (13%) Frame = +3 Query: 330 ISLLYDSEVAFSWIRV-----PVLCSSNDWRYSWSSQTVVPQIIQSKIT--------SSN 470 + LL + ++SW V + + R +W+ TV+ Q T S Sbjct: 187 LQLLMEKAASYSWSSVRNFHFSISSALEAGRLTWNDATVIRDRAQIAFTHADLRSASQSA 246 Query: 471 PTNGLSFTGQSKSTHWVRDHRVHHKYSDTDADP 569 P NG+S+ ++K + +D K+S DP Sbjct: 247 PRNGISYAAKAKKELYCKDWNHTGKFSCPSTDP 279 >SB_14976| Best HMM Match : rve (HMM E-Value=1.3e-38) Length = 1172 Score = 28.7 bits (61), Expect = 4.8 Identities = 18/53 (33%), Positives = 26/53 (49%) Frame = -3 Query: 372 ESN*RPLRCRTTKI*AIKHCNV*INMYEYIFIDDFIFSRSTTEGLTLSCSRLE 214 +SN RC T + I+ N+ N ++ +DDF+F TT T CS E Sbjct: 1032 QSNGEVERCNRTILKVIRIANLQGNDWKKA-LDDFLFQYRTTNHATTGCSPAE 1083 >SB_37799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -1 Query: 605 YMRIKEATACVMWICVRIAVLVMDS 531 Y R+++A CV CVR VL DS Sbjct: 30 YFRLEDAKRCVQPACVRHGVLTRDS 54 >SB_14824| Best HMM Match : F5_F8_type_C (HMM E-Value=1.5e-17) Length = 409 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/48 (25%), Positives = 22/48 (45%) Frame = +3 Query: 411 SWSSQTVVPQIIQSKITSSNPTNGLSFTGQSKSTHWVRDHRVHHKYSD 554 SW S T +Q + S G++ G +WV+ ++V H + + Sbjct: 39 SWCSVTSSSGYLQVDLGSRKTVTGIATHGDHTRDNWVKKYKVLHSHDN 86 >SB_5572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.9 bits (59), Expect = 8.4 Identities = 18/60 (30%), Positives = 29/60 (48%) Frame = +1 Query: 460 PLQILLMVFLSLANQRAPIGFETIESITSTAIRTQIHITQAVASFILI*VGCSSXNTLKL 639 PL+++L LS N P+G I + AI I I A+A I I + ++ T+ + Sbjct: 58 PLRVILKPLLSDYNDYNPVGGVAIAIAIAIAIAIAIAIAIAIAIAIAIAIAIANSITISI 117 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,972,794 Number of Sequences: 59808 Number of extensions: 462368 Number of successful extensions: 1088 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1019 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1087 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -