BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30707.Seq (598 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g28770.1 68416.m03591 expressed protein 31 0.58 At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing ... 28 5.4 At5g54020.1 68418.m06719 expressed protein 27 7.2 At3g10680.1 68416.m01284 heat shock protein-related contains wea... 27 9.5 >At3g28770.1 68416.m03591 expressed protein Length = 2081 Score = 31.1 bits (67), Expect = 0.58 Identities = 19/53 (35%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Frame = +3 Query: 222 EGAQKEDQRSRKENKG-KPEPKPAKGVTVPTRKGIKETQNVKSHXIKSGEQQK 377 E Q + S K KG K E K AK V K + T+N +SGE K Sbjct: 773 ENVQGNKKESEKVEKGEKKESKDAKSVETKDNKKLSSTENRDEAKERSGEDNK 825 >At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1003 Score = 27.9 bits (59), Expect = 5.4 Identities = 20/83 (24%), Positives = 42/83 (50%), Gaps = 3/83 (3%) Frame = +3 Query: 147 SSEQIRSFLGR*DRSS*CVKSARAGE--GAQKEDQRSR-KENKGKPEPKPAKGVTVPTRK 317 S E+ +S + D ++ + R E + K+ Q R KE KP+PK +K ++ P ++ Sbjct: 877 SKEEAKSNIAVKDNAAEKKRPIRTQEKPSSNKKGQLMRQKETTEKPDPKISKDLSEPRKR 936 Query: 318 GIKETQNVKSHXIKSGEQQKGKG 386 E + ++ + +++G+G Sbjct: 937 KFGEDRGEENRNGQRKRKKQGQG 959 >At5g54020.1 68418.m06719 expressed protein Length = 556 Score = 27.5 bits (58), Expect = 7.2 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 Query: 41 DKMSPY*CAESNPITSKYCVIKSSR 115 D +PY C E N + KYC+ K R Sbjct: 154 DDRNPYVCLECNLMVHKYCIEKLPR 178 >At3g10680.1 68416.m01284 heat shock protein-related contains weak similarity to Pfam profile PF00011: Hsp20/alpha crystallin family Length = 490 Score = 27.1 bits (57), Expect = 9.5 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +3 Query: 204 KSARAGEGAQKEDQRSRKENKGKPEPKPAKGVTVPTRKGIKETQNV 341 K +A + +K QRS +E G P P G T+ +K ++E + V Sbjct: 116 KQEKAVQDQEKIGQRSNQEKSGGPGP---NGSTLGRKKALEEEKQV 158 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,924,719 Number of Sequences: 28952 Number of extensions: 157484 Number of successful extensions: 436 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 425 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 436 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1190791976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -