BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30699.Seq (554 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47363| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_228| Best HMM Match : SAM_1 (HMM E-Value=10) 32 0.36 SB_3614| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_35353| Best HMM Match : Arm (HMM E-Value=6.6e-27) 28 4.5 SB_45788| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.8 >SB_47363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 99.1 bits (236), Expect = 2e-21 Identities = 47/60 (78%), Positives = 50/60 (83%) Frame = +3 Query: 255 AISKALIAFYQKYVDEASKKXIXXILVQYDRXLLVAXPRRCEPKKFGGPGARXXYQKSYR 434 AISK+L+A+YQKYVDE SKK I ILVQYDR LLVA PRR E KKFGGPGAR YQKSYR Sbjct: 48 AISKSLVAYYQKYVDEVSKKEIRDILVQYDRSLLVADPRRTEAKKFGGPGARSRYQKSYR 107 Score = 59.7 bits (138), Expect(2) = 1e-09 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = +1 Query: 145 KLQEPILLLGKEKFSMVXIRVTVKGGGHVAQVYAIRQLFQR 267 K++EPILLLGKE+F V IRV VKGGGH +++YAIRQ + Sbjct: 11 KVEEPILLLGKERFEGVDIRVRVKGGGHTSRIYAIRQAISK 51 Score = 20.6 bits (41), Expect(2) = 1e-09 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = +1 Query: 19 QAVQVFGRK 45 Q+VQVFGRK Sbjct: 3 QSVQVFGRK 11 >SB_228| Best HMM Match : SAM_1 (HMM E-Value=10) Length = 119 Score = 31.9 bits (69), Expect = 0.36 Identities = 15/48 (31%), Positives = 28/48 (58%) Frame = +3 Query: 237 SLRYQTAISKALIAFYQKYVDEASKKXIXXILVQYDRXLLVAXPRRCE 380 +++++T + L AF QKY+D +K +Q+ + +LV+ R CE Sbjct: 43 AVKHKTHVDTVL-AFRQKYLDNFGRKETSKRFLQFAQGVLVSLARECE 89 >SB_3614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 28.3 bits (60), Expect = 4.5 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = -3 Query: 189 REFFLAEQKDRFLKFVLQQSGLNQ--VQWAP 103 R F + KDR+LK L++ G Q QW P Sbjct: 12 RSFLFTQDKDRYLKAGLKKYGYGQWTAQWVP 42 >SB_35353| Best HMM Match : Arm (HMM E-Value=6.6e-27) Length = 513 Score = 28.3 bits (60), Expect = 4.5 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +3 Query: 222 WSCSTSLRYQTAISKA 269 WSCSTS+R +T+I KA Sbjct: 155 WSCSTSMRNRTSIFKA 170 >SB_45788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 27.5 bits (58), Expect = 7.8 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = +3 Query: 81 SWNAACKRAPIGLG*AQTAAVQTSGTYPFARQGKILYG 194 SW A K+ P G G ++ +G Y R G+ YG Sbjct: 19 SWQNAEKKKPAGFGRGRSKRGYVNGNYEARRPGERSYG 56 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,943,595 Number of Sequences: 59808 Number of extensions: 295843 Number of successful extensions: 752 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 702 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 752 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1288581898 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -