BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30698.Seq (698 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1347.12 |||actin-like protein Arp1 |Schizosaccharomyces pomb... 27 3.4 SPBC23E6.01c ||SPBPJ758.01|RNA-binding protein, rrm type|Schizos... 27 3.4 SPBC2A9.10 |||Bin3 family|Schizosaccharomyces pombe|chr 2|||Manual 26 4.5 SPAC15E1.04 |||thymidylate synthase |Schizosaccharomyces pombe|c... 25 7.9 >SPBC1347.12 |||actin-like protein Arp1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 379 Score = 26.6 bits (56), Expect = 3.4 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = +3 Query: 57 DVDGRLLLYSSCRSAGGSTI**EKSASFYRRLRH*SGKR 173 D+D R LYS+ +GGST+ F LR SGK+ Sbjct: 291 DIDLRSTLYSNIVLSGGSTLLRGFGERFISELRAISGKK 329 >SPBC23E6.01c ||SPBPJ758.01|RNA-binding protein, rrm type|Schizosaccharomyces pombe|chr 2|||Manual Length = 473 Score = 26.6 bits (56), Expect = 3.4 Identities = 12/38 (31%), Positives = 16/38 (42%) Frame = -3 Query: 264 DYSAKLMSRYNQCNQVQQCRNPTILCIQGISFFHFNDE 151 D + SRYN C + +P +G F F DE Sbjct: 201 DVYSLFASRYNSCKSAKIMTDPQTNVSRGYGFVRFTDE 238 >SPBC2A9.10 |||Bin3 family|Schizosaccharomyces pombe|chr 2|||Manual Length = 268 Score = 26.2 bits (55), Expect = 4.5 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = -2 Query: 286 YYILTEERLFSKIDVQIQPV*SSTTMPQSNNFVHSGYI 173 YY ++ + FS+I VQ+QP + P + F + ++ Sbjct: 102 YYPISSIKKFSRIPVQLQPPLNKQNFPHNIEFETADFL 139 >SPAC15E1.04 |||thymidylate synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 625 Score = 25.4 bits (53), Expect = 7.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -3 Query: 546 LDAKGRGSFIVADMGEVYIQQWRDTG 469 LD++G V D+G +Y QWR G Sbjct: 420 LDSRGLTDRKVGDLGPIYGFQWRHFG 445 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,892,105 Number of Sequences: 5004 Number of extensions: 60320 Number of successful extensions: 147 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 144 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 147 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -