BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30696.Seq (697 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z70684-8|CAA94603.2| 360|Caenorhabditis elegans Hypothetical pr... 28 7.3 M77697-6|AAA27901.2| 603|Caenorhabditis elegans Hypothetical pr... 27 9.7 >Z70684-8|CAA94603.2| 360|Caenorhabditis elegans Hypothetical protein F28D1.8 protein. Length = 360 Score = 27.9 bits (59), Expect = 7.3 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +3 Query: 204 KSARAGEGAQKEDQRSRKENKGKPEPKPAKGVTVPTRK 317 K + AG+G K+ + KE KG + + K + PT+K Sbjct: 321 KKSGAGKGKGKKKSKVSKEKKGGKKVQKKKPASKPTKK 358 >M77697-6|AAA27901.2| 603|Caenorhabditis elegans Hypothetical protein B0303.9 protein. Length = 603 Score = 27.5 bits (58), Expect = 9.7 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -1 Query: 676 GIFRSKLTFASMSKETRPARSLTRLTRVVLVDR 578 G R+ SM+K P L ++ R+VL+DR Sbjct: 227 GKIRNSAEADSMTKNLDPIEGLLKINRIVLIDR 259 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,413,129 Number of Sequences: 27780 Number of extensions: 208403 Number of successful extensions: 592 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 567 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 589 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1602927856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -