BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30693.Seq (748 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 25 2.5 EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton anti... 23 7.6 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 25.0 bits (52), Expect = 2.5 Identities = 17/47 (36%), Positives = 19/47 (40%) Frame = +3 Query: 603 RADEGRQVRAPHLQQQVT*NGXRGSSKTRAXASACFNGGVTNAGRAG 743 RA G QQQ N R + + AS C GGV A AG Sbjct: 570 RAGGGVGATGAEKQQQNRSNHHRTTEQADREASVCAAGGVGAAAAAG 616 >EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton antiporter protein. Length = 647 Score = 23.4 bits (48), Expect = 7.6 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 128 LTAETFGFKINANGTSLKKKQIWTLEPASG 217 LTA I+ GT L KK LEP G Sbjct: 565 LTAPLGAILISVTGTKLLKKTKQQLEPLDG 594 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 652,778 Number of Sequences: 2352 Number of extensions: 11490 Number of successful extensions: 22 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76923555 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -