BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30686.Seq (548 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 24 1.2 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 24 1.2 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 24 1.2 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 24 1.2 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 24 1.2 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 1.5 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 23 2.7 AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 ... 22 3.6 AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-act... 21 6.2 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 21 6.2 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 21 6.2 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 21 6.2 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 23.8 bits (49), Expect = 1.2 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Frame = +2 Query: 35 KEKYAKYLPHSAGRYAHK--RFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRI 187 + Y KY S R + R R + I+ L+N + + NN KKL I Sbjct: 53 ENSYRKYRETSKERSRDRKERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNI 105 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 23.8 bits (49), Expect = 1.2 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Frame = +2 Query: 35 KEKYAKYLPHSAGRYAHK--RFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRI 187 + Y KY S R + R R + I+ L+N + + NN KKL I Sbjct: 53 ENSYRKYRETSKERSRDRKERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNI 105 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 23.8 bits (49), Expect = 1.2 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Frame = +2 Query: 35 KEKYAKYLPHSAGRYAHK--RFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRI 187 + Y KY S R + R R + I+ L+N + + NN KKL I Sbjct: 53 ENSYRKYRETSKERSRDRKERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNI 105 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 23.8 bits (49), Expect = 1.2 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Frame = +2 Query: 35 KEKYAKYLPHSAGRYAHK--RFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRI 187 + Y KY S R + R R + I+ L+N + + NN KKL I Sbjct: 53 ENSYRKYRETSKERSRDRKERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNI 105 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 23.8 bits (49), Expect = 1.2 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Frame = +2 Query: 35 KEKYAKYLPHSAGRYAHK--RFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRI 187 + Y KY S R + R R + I+ L+N + + NN KKL I Sbjct: 286 ENSYRKYRETSKERSRDRKERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNI 338 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.4 bits (48), Expect = 1.5 Identities = 9/28 (32%), Positives = 10/28 (35%) Frame = -3 Query: 432 CNTLCDCFNISECSLTCTCAQKPDCLVD 349 C LC C + C TC C D Sbjct: 743 CFALCHCCDFDACDCEMTCPAGCKCYND 770 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 22.6 bits (46), Expect = 2.7 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +2 Query: 185 IVKHAFEIIHLLTGENPLQVLVTALSTLDPVKIR 286 +++HAFEI +L P+ +++ L L +K+R Sbjct: 217 LIEHAFEISTMLFFVLPMTIII-VLYILIAIKLR 249 >AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 protein. Length = 134 Score = 22.2 bits (45), Expect = 3.6 Identities = 12/56 (21%), Positives = 26/56 (46%) Frame = +1 Query: 367 LLCTGAREAAFRNIKTIAECVADELINAAKGSSNSYAIKKKDELERVVNPTVKIYY 534 +L TG R+ N+K + + A+ + + K+K +ER ++++ Y Sbjct: 68 MLPTGFRKVLVHNVKELEVLMMQNRKFCAEIAHGGSSKKRKSIVERAQQLSIRVTY 123 >AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-activated ion channelvariant T protein. Length = 288 Score = 21.4 bits (43), Expect = 6.2 Identities = 5/19 (26%), Positives = 12/19 (63%) Frame = -3 Query: 153 RPCIIREFVRRSTIGHWAL 97 + +++E +R+ GHW + Sbjct: 63 KKALMKERIRQKAAGHWVI 81 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 21.4 bits (43), Expect = 6.2 Identities = 5/19 (26%), Positives = 12/19 (63%) Frame = -3 Query: 153 RPCIIREFVRRSTIGHWAL 97 + +++E +R+ GHW + Sbjct: 63 KKALMKERIRQKAAGHWVI 81 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 21.4 bits (43), Expect = 6.2 Identities = 5/19 (26%), Positives = 12/19 (63%) Frame = -3 Query: 153 RPCIIREFVRRSTIGHWAL 97 + +++E +R+ GHW + Sbjct: 63 KKALMKERIRQKAAGHWVI 81 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 21.4 bits (43), Expect = 6.2 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -3 Query: 135 EFVRRSTIGHWALRKRLCAYLPAE 64 EF R T AL K+LC PAE Sbjct: 585 EFPRSITRNATALIKKLCRDNPAE 608 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,442 Number of Sequences: 438 Number of extensions: 3006 Number of successful extensions: 13 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15704448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -