BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30679.Seq (748 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC513.06c |||dihydrodiol dehydrogenase |Schizosaccharomyces po... 27 2.8 SPCC576.14 |||diphthine synthase |Schizosaccharomyces pombe|chr ... 26 6.6 >SPAC513.06c |||dihydrodiol dehydrogenase |Schizosaccharomyces pombe|chr 1|||Manual Length = 368 Score = 27.1 bits (57), Expect = 2.8 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = -1 Query: 706 LIHTGFVRAGSSVEITFASIVKRTRSRAVPHEAHAVVLVDRDALHR 569 +IH GF+ AGS + +V V HE V + RD+ HR Sbjct: 10 VIHWGFLGAGSIAAVFAKDLVGVPERHKVQHE--IVAVATRDSEHR 53 >SPCC576.14 |||diphthine synthase |Schizosaccharomyces pombe|chr 3|||Manual Length = 283 Score = 25.8 bits (54), Expect = 6.6 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -1 Query: 685 RAGSSVEITFASIVKRTRSRAVPHEAHAVVLVDRD 581 R GS ++ FA ++ + H+VVLV RD Sbjct: 220 RMGSDDQVIFAGTLQELAEHDIGPPLHSVVLVGRD 254 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,398,395 Number of Sequences: 5004 Number of extensions: 37205 Number of successful extensions: 77 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 77 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 355273338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -