BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30679.Seq (748 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52294| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 >SB_52294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 394 Score = 37.9 bits (84), Expect = 0.009 Identities = 18/30 (60%), Positives = 22/30 (73%), Gaps = 2/30 (6%) Frame = +2 Query: 647 NRG--KRDFDRRSGSDKTGVNQFDKXEGAG 730 NRG KR+F+RRSGSD++ V DK EG G Sbjct: 165 NRGGRKREFERRSGSDRSSVKPQDKREGGG 194 Score = 32.7 bits (71), Expect = 0.33 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +2 Query: 143 YGVGVVNRYALFLDDETDPLDALKAREQA 229 Y +GV NR+ L L DE DP K E+A Sbjct: 6 YSIGVNNRFGLLLSDEEDPETTFKESEKA 34 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,934,189 Number of Sequences: 59808 Number of extensions: 304871 Number of successful extensions: 510 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 485 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 508 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2022185256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -