BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30678.Seq (424 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578807-1|AAT07312.1| 438|Anopheles gambiae punt protein. 24 2.6 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 22 8.0 >AY578807-1|AAT07312.1| 438|Anopheles gambiae punt protein. Length = 438 Score = 23.8 bits (49), Expect = 2.6 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +2 Query: 32 DNAILLAVKPKLLQKMYEHNGLKATRELYED 124 DN + ++P++ H GL A E ED Sbjct: 359 DNVVTKKLRPRIFDPWRHHPGLVAICETMED 389 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 22.2 bits (45), Expect = 8.0 Identities = 12/41 (29%), Positives = 15/41 (36%) Frame = -1 Query: 175 IDHYFMKFNLCWWCPNKIFIQFPSSFQAIMFVHFL*KFWFN 53 + HY F WC + + P I F H L FN Sbjct: 721 LQHYLNAF--VHWCSSNLLRLCPDKCSVISFSHSLSPISFN 759 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 404,809 Number of Sequences: 2352 Number of extensions: 7107 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 35060166 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -