BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30677.Seq (709 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U40799-7|AAA81485.1| 208|Caenorhabditis elegans Ribosomal prote... 146 2e-35 >U40799-7|AAA81485.1| 208|Caenorhabditis elegans Ribosomal protein, small subunitprotein 8 protein. Length = 208 Score = 146 bits (353), Expect = 2e-35 Identities = 92/212 (43%), Positives = 122/212 (57%), Gaps = 4/212 (1%) Frame = +1 Query: 31 MGISRDHWHKRRATG-WETCAHTQEE-EV*VRASRCKHQARPSANPLRSFTWWKY*VPCA 204 MGISRD WHKR TG + H + + E+ A+ K A KY Sbjct: 1 MGISRDSWHKRYKTGATQPVPHKKRKFELGRPAANTKIGAHRVRLVRTRGGNEKYRALRL 60 Query: 205 ASGHR*LLLGIGMFNSQTRIIDVVYNASNNELVRTKTLVKNAIVVVDATPFRQWYESHYT 384 SG+ +TRI+D +YNA+NNELVRTKTLVK AI+ VDA PFRQWYE+HY Sbjct: 61 DSGN--FSWASEQTTRKTRIVDTMYNATNNELVRTKTLVKGAIISVDAAPFRQWYEAHYA 118 Query: 385 LPLGRKKGAKLTEAEEAIINKKRSQKTARKYLARQRLAKVEVL--*KSNSTQGVCWLAWR 558 LPL RKK AKL+E + AI+NKKRS T +KY RQ+ A V+ L + N+ + + ++ Sbjct: 119 LPLARKKNAKLSEEDNAILNKKRSHHTMKKYTERQKTAAVDALLIEQFNTGRLLARISSS 178 Query: 559 VAQVSVVAPMVTS*KAKNFEFYLRKIKSKRAK 654 QV + + K +FYLRKI++K+AK Sbjct: 179 PGQVGQANGYIL--EGKELDFYLRKIRAKKAK 208 Score = 90.2 bits (214), Expect = 1e-18 Identities = 41/61 (67%), Positives = 49/61 (80%), Gaps = 1/61 (1%) Frame = +2 Query: 77 GKRAPI-RKKRKYELGRPAANTRLGPQRIHSVRSRGGNTKYRALRLDTGNFSWGSECSTR 253 G P+ KKRK+ELGRPAANT++G R+ VR+RGGN KYRALRLD+GNFSW SE +TR Sbjct: 15 GATQPVPHKKRKFELGRPAANTKIGAHRVRLVRTRGGNEKYRALRLDSGNFSWASEQTTR 74 Query: 254 K 256 K Sbjct: 75 K 75 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,286,712 Number of Sequences: 27780 Number of extensions: 324202 Number of successful extensions: 904 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 857 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 902 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1645110168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -