BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30673.Seq (748 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g77510.1 68414.m09026 protein disulfide isomerase, putative s... 83 3e-16 At1g21750.2 68414.m02723 protein disulfide isomerase, putative s... 83 3e-16 At1g21750.1 68414.m02722 protein disulfide isomerase, putative s... 83 3e-16 At5g60640.2 68418.m07611 thioredoxin family protein similar to p... 82 4e-16 At5g60640.1 68418.m07610 thioredoxin family protein similar to p... 82 4e-16 At3g54960.1 68416.m06094 thioredoxin family protein similar to p... 77 2e-14 At1g52260.1 68414.m05897 thioredoxin family protein similar to p... 74 1e-13 At2g47470.2 68415.m05924 thioredoxin family protein similar to p... 68 8e-12 At2g47470.1 68415.m05925 thioredoxin family protein similar to p... 68 8e-12 At3g16110.1 68416.m02035 thioredoxin family protein similar to p... 63 2e-10 At1g35620.1 68414.m04425 thioredoxin family protein similar to S... 62 5e-10 At1g04980.1 68414.m00497 thioredoxin family protein similar to S... 58 5e-09 At2g32920.1 68415.m04036 thioredoxin family protein similar to S... 56 2e-08 At4g27080.1 68417.m03893 thioredoxin family protein contains Pfa... 46 3e-05 At2g01270.1 68415.m00040 thioredoxin family protein low similari... 42 4e-04 At1g15020.2 68414.m01795 thioredoxin family protein low similari... 41 8e-04 At1g15020.1 68414.m01794 thioredoxin family protein low similari... 41 8e-04 At1g62180.1 68414.m07014 5'-adenylylsulfate reductase 2, chlorop... 41 0.001 At4g37200.1 68417.m05266 thioredoxin family protein contains Pfa... 40 0.002 At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38... 38 0.005 At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-... 38 0.005 At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38... 38 0.009 At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / P... 37 0.012 At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-... 37 0.012 At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-... 37 0.012 At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) i... 37 0.012 At3g20560.1 68416.m02603 thioredoxin family protein contains Pfa... 37 0.016 At1g50950.1 68414.m05728 thioredoxin-related contains weak hit t... 37 0.016 At5g61440.1 68418.m07709 thioredoxin family protein low similari... 36 0.029 At4g04950.1 68417.m00719 thioredoxin family protein similar to P... 36 0.029 At1g34780.1 68414.m04329 protein disulfide isomerase-related con... 36 0.029 At4g21990.1 68417.m03183 5'-adenylylsulfate reductase (APR3) / P... 36 0.038 At2g33270.1 68415.m04078 thioredoxin family protein contains Pfa... 36 0.038 At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identica... 35 0.050 At1g50320.1 68414.m05641 thioredoxin x nearly identical to thior... 35 0.050 At4g29670.2 68417.m04227 thioredoxin family protein contains Pfa... 35 0.066 At4g29670.1 68417.m04226 thioredoxin family protein contains Pfa... 35 0.066 At4g26160.1 68417.m03765 thioredoxin family protein low similari... 35 0.066 At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29... 34 0.12 At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29... 33 0.20 At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) i... 33 0.27 At3g19780.1 68416.m02504 expressed protein 33 0.27 At1g76760.1 68414.m08933 thioredoxin family protein similar to t... 33 0.27 At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) i... 33 0.27 At1g43560.1 68414.m05000 thioredoxin family protein contains Pfa... 32 0.35 At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to te... 31 0.61 At4g32580.1 68417.m04638 thioredoxin family protein contains Pfa... 31 0.81 At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-... 31 0.81 At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) i... 31 1.1 At4g08930.1 68417.m01470 thioredoxin-related contains weak simil... 31 1.1 At3g06730.1 68416.m00798 thioredoxin family protein contains Pfa... 30 1.4 At1g08570.1 68414.m00950 thioredoxin family protein contains Pfa... 30 1.4 At1g07960.3 68414.m00867 thioredoxin family protein low similari... 30 1.9 At1g07960.2 68414.m00866 thioredoxin family protein low similari... 30 1.9 At1g07960.1 68414.m00865 thioredoxin family protein low similari... 30 1.9 At3g08710.1 68416.m01012 thioredoxin family protein similar to t... 29 2.5 At1g52990.1 68414.m05997 thioredoxin family protein similar to S... 29 2.5 At2g24610.1 68415.m02940 cyclic nucleotide-regulated ion channel... 29 4.3 At1g49900.1 68414.m05596 zinc finger (C2H2 type) family protein ... 28 5.7 At1g11530.1 68414.m01324 thioredoxin family protein similar to t... 28 5.7 At5g35910.1 68418.m04312 3'-5' exonuclease domain-containing pro... 28 7.6 At4g30360.1 68417.m04314 cyclic nucleotide-regulated ion channel... 28 7.6 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 28 7.6 At1g15280.2 68414.m01829 glycine-rich protein 28 7.6 At1g15280.1 68414.m01828 glycine-rich protein 28 7.6 At5g64070.1 68418.m08046 phosphatidylinositol 4-kinase (PI4K) ne... 27 10.0 At4g08710.1 68417.m01439 hypothetical protein contains Pfam prof... 27 10.0 At3g61710.2 68416.m06916 autophagy protein Apg6 family contains ... 27 10.0 At3g61710.1 68416.m06915 autophagy protein Apg6 family contains ... 27 10.0 At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containi... 27 10.0 At1g74250.1 68414.m08599 DNAJ heat shock N-terminal domain-conta... 27 10.0 At1g53300.1 68414.m06041 thioredoxin family protein contains Pfa... 27 10.0 At1g07700.3 68414.m00829 thioredoxin family protein low similari... 27 10.0 At1g07700.2 68414.m00827 thioredoxin family protein low similari... 27 10.0 At1g07700.1 68414.m00828 thioredoxin family protein low similari... 27 10.0 >At1g77510.1 68414.m09026 protein disulfide isomerase, putative similar to protein disulfide isomerase precursor GB:P29828 GI:4704766 [Medicago sativa]; Pfam HMM hit: PF00085 Thioredoxins Length = 508 Score = 82.6 bits (195), Expect = 3e-16 Identities = 38/87 (43%), Positives = 61/87 (70%), Gaps = 4/87 (4%) Frame = +1 Query: 259 PIKLAKVDATQE--QDLAESYGVRGYPTLKFFRNG--SPIDYSGGRQADDIISWLKKKTG 426 P+ LAK+DA++E ++ A Y ++G+PTLK RNG S DY+G R+A+ I+++LKK++G Sbjct: 81 PLALAKIDASEEANKEFANEYKIQGFPTLKILRNGGKSVQDYNGPREAEGIVTYLKKQSG 140 Query: 427 PPAVEVTSAEQAKELIDANTVIVFGFF 507 P +VE+ SA+ A E++ V+ G F Sbjct: 141 PASVEIKSADSATEVVGEKNVVAVGVF 167 Score = 71.7 bits (168), Expect = 5e-13 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 2/71 (2%) Frame = +2 Query: 50 FTAIALLGLALGD--EVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEY 223 F+ + LL L + T+E VL L +NF I+ ++I+VEFYAPWCGHC+ LAPEY Sbjct: 9 FSILLLLSLFVSSIRSEETKEFVLTLDHSNFTETISKHDFIVVEFYAPWCGHCQKLAPEY 68 Query: 224 AKAATKLAEED 256 KAA++L+ + Sbjct: 69 EKAASELSSHN 79 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/45 (42%), Positives = 31/45 (68%), Gaps = 3/45 (6%) Frame = +2 Query: 92 VPTEENV---LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 217 +P E N +V++++ + V + + +L+EFYAPWCGHC+ LAP Sbjct: 366 IPAENNEPVKVVVAESLDDIVFKSGKNVLIEFYAPWCGHCQKLAP 410 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/53 (32%), Positives = 35/53 (66%), Gaps = 1/53 (1%) Frame = +1 Query: 268 LAKVDATQEQDLAESYGVRGYPTLKF-FRNGSPIDYSGGRQADDIISWLKKKT 423 +AK+DAT ++++ V+G+PT+ F +G+ + Y G R +D I++++K + Sbjct: 427 IAKLDATANDIPSDTFDVKGFPTIYFRSASGNVVVYEGDRTKEDFINFVEKNS 479 >At1g21750.2 68414.m02723 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 487 Score = 82.6 bits (195), Expect = 3e-16 Identities = 37/87 (42%), Positives = 61/87 (70%), Gaps = 4/87 (4%) Frame = +1 Query: 259 PIKLAKVDATQE--QDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQADDIISWLKKKTG 426 P+ LAK+DA++E ++ A Y V+G+PT+K FRNG +Y+G R+A+ I+++LKK++G Sbjct: 82 PVVLAKIDASEETNREFATQYEVQGFPTIKIFRNGGKAVQEYNGPREAEGIVTYLKKQSG 141 Query: 427 PPAVEVTSAEQAKELIDANTVIVFGFF 507 P + E+ SA+ A E++ V+V G F Sbjct: 142 PASAEIKSADDASEVVSDKKVVVVGIF 168 Score = 73.7 bits (173), Expect = 1e-13 Identities = 36/72 (50%), Positives = 46/72 (63%), Gaps = 6/72 (8%) Frame = +2 Query: 50 FTAIALLGLAL------GDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSL 211 FT ++L L+L +E T+E VL L NF I ++I+VEFYAPWCGHCK L Sbjct: 6 FTLFSILVLSLCASSIRSEETETKEFVLTLDHTNFTDTINKHDFIVVEFYAPWCGHCKQL 65 Query: 212 APEYAKAATKLA 247 APEY KAA+ L+ Sbjct: 66 APEYEKAASALS 77 Score = 48.0 bits (109), Expect = 7e-06 Identities = 20/45 (44%), Positives = 31/45 (68%), Gaps = 3/45 (6%) Frame = +2 Query: 92 VPTEENV---LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 217 +P E N +V+S + + V+ + + +L+EFYAPWCGHC+ LAP Sbjct: 368 IPAENNEPVKVVVSDSLDDIVLNSGKNVLLEFYAPWCGHCQKLAP 412 Score = 36.3 bits (80), Expect = 0.022 Identities = 16/54 (29%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Frame = +1 Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKF-FRNGSPIDYSGGRQADDIISWLK 414 S + +AK+DAT +++ V+G+PT+ F +G+ + Y G RQ + + +++ Sbjct: 425 SSVVIAKLDATANDFPKDTFDVKGFPTIYFKSASGNVVVYEGDRQRESLYLFIR 478 >At1g21750.1 68414.m02722 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 501 Score = 82.6 bits (195), Expect = 3e-16 Identities = 37/87 (42%), Positives = 61/87 (70%), Gaps = 4/87 (4%) Frame = +1 Query: 259 PIKLAKVDATQE--QDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQADDIISWLKKKTG 426 P+ LAK+DA++E ++ A Y V+G+PT+K FRNG +Y+G R+A+ I+++LKK++G Sbjct: 82 PVVLAKIDASEETNREFATQYEVQGFPTIKIFRNGGKAVQEYNGPREAEGIVTYLKKQSG 141 Query: 427 PPAVEVTSAEQAKELIDANTVIVFGFF 507 P + E+ SA+ A E++ V+V G F Sbjct: 142 PASAEIKSADDASEVVSDKKVVVVGIF 168 Score = 73.7 bits (173), Expect = 1e-13 Identities = 36/72 (50%), Positives = 46/72 (63%), Gaps = 6/72 (8%) Frame = +2 Query: 50 FTAIALLGLAL------GDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSL 211 FT ++L L+L +E T+E VL L NF I ++I+VEFYAPWCGHCK L Sbjct: 6 FTLFSILVLSLCASSIRSEETETKEFVLTLDHTNFTDTINKHDFIVVEFYAPWCGHCKQL 65 Query: 212 APEYAKAATKLA 247 APEY KAA+ L+ Sbjct: 66 APEYEKAASALS 77 Score = 48.0 bits (109), Expect = 7e-06 Identities = 20/45 (44%), Positives = 31/45 (68%), Gaps = 3/45 (6%) Frame = +2 Query: 92 VPTEENV---LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 217 +P E N +V+S + + V+ + + +L+EFYAPWCGHC+ LAP Sbjct: 368 IPAENNEPVKVVVSDSLDDIVLNSGKNVLLEFYAPWCGHCQKLAP 412 Score = 44.8 bits (101), Expect = 6e-05 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 4/75 (5%) Frame = +1 Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKF-FRNGSPIDYSGGRQADDIISWLKKK---T 423 S + +AK+DAT +++ V+G+PT+ F +G+ + Y G R +D IS++ K Sbjct: 425 SSVVIAKLDATANDFPKDTFDVKGFPTIYFKSASGNVVVYEGDRTKEDFISFVDKNKDTV 484 Query: 424 GPPAVEVTSAEQAKE 468 G P E + E+ K+ Sbjct: 485 GEPKKEEETTEEVKD 499 >At5g60640.2 68418.m07611 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 536 Score = 81.8 bits (193), Expect = 4e-16 Identities = 33/81 (40%), Positives = 56/81 (69%) Frame = +1 Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441 + LAK+DAT+E +LA+ Y V+G+PTL FF +G Y+GGR + I++W+KKK GP Sbjct: 154 VVLAKIDATEENELAQEYRVQGFPTLLFFVDGEHKPYTGGRTKETIVTWVKKKIGPGVYN 213 Query: 442 VTSAEQAKELIDANTVIVFGF 504 +T+ + A++++ + +V G+ Sbjct: 214 LTTLDDAEKVLTSGNKVVLGY 234 Score = 80.6 bits (190), Expect = 1e-15 Identities = 37/69 (53%), Positives = 50/69 (72%), Gaps = 4/69 (5%) Frame = +2 Query: 68 LGLALGDEVPT----EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 235 LG D +PT E++V+V+ + NF VI +Y+LVEFYAPWCGHC+SLAPEYA AA Sbjct: 87 LGNPDSDPLPTPEIDEKDVVVIKERNFTDVIENNQYVLVEFYAPWCGHCQSLAPEYAAAA 146 Query: 236 TKLAEEDLL 262 T+L E+ ++ Sbjct: 147 TELKEDGVV 155 Score = 52.4 bits (120), Expect = 3e-07 Identities = 26/62 (41%), Positives = 38/62 (61%), Gaps = 3/62 (4%) Frame = +2 Query: 86 DEVP--TEENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256 D +P +E+V ++ NF E V+ ++ +L+E YAPWCGHC++L P Y K A L D Sbjct: 433 DPIPEKNDEDVKIVVGDNFDEIVLDDSKDVLLEVYAPWCGHCQALEPMYNKLAKHLRSID 492 Query: 257 LL 262 L Sbjct: 493 SL 494 >At5g60640.1 68418.m07610 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 597 Score = 81.8 bits (193), Expect = 4e-16 Identities = 33/81 (40%), Positives = 56/81 (69%) Frame = +1 Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441 + LAK+DAT+E +LA+ Y V+G+PTL FF +G Y+GGR + I++W+KKK GP Sbjct: 154 VVLAKIDATEENELAQEYRVQGFPTLLFFVDGEHKPYTGGRTKETIVTWVKKKIGPGVYN 213 Query: 442 VTSAEQAKELIDANTVIVFGF 504 +T+ + A++++ + +V G+ Sbjct: 214 LTTLDDAEKVLTSGNKVVLGY 234 Score = 80.6 bits (190), Expect = 1e-15 Identities = 37/69 (53%), Positives = 50/69 (72%), Gaps = 4/69 (5%) Frame = +2 Query: 68 LGLALGDEVPT----EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 235 LG D +PT E++V+V+ + NF VI +Y+LVEFYAPWCGHC+SLAPEYA AA Sbjct: 87 LGNPDSDPLPTPEIDEKDVVVIKERNFTDVIENNQYVLVEFYAPWCGHCQSLAPEYAAAA 146 Query: 236 TKLAEEDLL 262 T+L E+ ++ Sbjct: 147 TELKEDGVV 155 Score = 52.4 bits (120), Expect = 3e-07 Identities = 26/62 (41%), Positives = 38/62 (61%), Gaps = 3/62 (4%) Frame = +2 Query: 86 DEVP--TEENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256 D +P +E+V ++ NF E V+ ++ +L+E YAPWCGHC++L P Y K A L D Sbjct: 433 DPIPEKNDEDVKIVVGDNFDEIVLDDSKDVLLEVYAPWCGHCQALEPMYNKLAKHLRSID 492 Query: 257 LL 262 L Sbjct: 493 SL 494 >At3g54960.1 68416.m06094 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 579 Score = 76.6 bits (180), Expect = 2e-14 Identities = 35/80 (43%), Positives = 52/80 (65%), Gaps = 1/80 (1%) Frame = +1 Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAVEV 444 LAK+DAT+E DLA+ Y ++G+PT+ F +G Y G R D I++WLKKK P + Sbjct: 151 LAKIDATEEGDLAQKYEIQGFPTVFLFVDGEMRKTYEGERTKDGIVTWLKKKASPSIHNI 210 Query: 445 TSAEQAKELIDANTVIVFGF 504 T+ E+A+ ++ A +VFGF Sbjct: 211 TTKEEAERVLSAEPKLVFGF 230 Score = 63.7 bits (148), Expect = 1e-10 Identities = 26/48 (54%), Positives = 35/48 (72%) Frame = +2 Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244 E++V VL+K NF + + +VEFYAPWCG C++L PEYA AAT+L Sbjct: 98 EKDVAVLTKDNFTEFVGNNSFAMVEFYAPWCGACQALTPEYAAAATEL 145 Score = 48.0 bits (109), Expect = 7e-06 Identities = 30/83 (36%), Positives = 42/83 (50%), Gaps = 3/83 (3%) Frame = +2 Query: 23 DNIEMRVLIFTAIALLGLALGDEVP--TEENVLVLSKANF-ETVITTTEYILVEFYAPWC 193 +NI+ F A L D +P + +V V+ NF E V+ ++ +L+E YAPWC Sbjct: 408 NNIKTLAEDFLADKLKPFYKSDPLPENNDGDVKVIVGNNFDEIVLDESKDVLLEIYAPWC 467 Query: 194 GHCKSLAPEYAKAATKLAEEDLL 262 GHC+S P Y K L D L Sbjct: 468 GHCQSFEPIYNKLGKYLKGIDSL 490 >At1g52260.1 68414.m05897 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 537 Score = 73.7 bits (173), Expect = 1e-13 Identities = 29/84 (34%), Positives = 50/84 (59%) Frame = +1 Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPA 435 S + +AK+D + +A ++G+PTL F NG+ + Y+GG A+DI+ W++KKTG P Sbjct: 128 SSVLMAKIDGDRYSKIASELEIKGFPTLLLFVNGTSLTYNGGSSAEDIVIWVQKKTGAPI 187 Query: 436 VEVTSAEQAKELIDANTVIVFGFF 507 + + + ++A +D V G F Sbjct: 188 ITLNTVDEAPRFLDKYHTFVLGLF 211 Score = 41.5 bits (93), Expect = 6e-04 Identities = 20/47 (42%), Positives = 27/47 (57%) Frame = +2 Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250 VL L+ + VI E+++V YAPWC L P +A+AAT L E Sbjct: 79 VLELNGDYTKRVIDGNEFVMVLGYAPWCARSAELMPRFAEAATALKE 125 >At2g47470.2 68415.m05924 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 266 Score = 67.7 bits (158), Expect = 8e-12 Identities = 30/52 (57%), Positives = 38/52 (73%), Gaps = 1/52 (1%) Frame = +2 Query: 104 ENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256 +NV+VL+ NF E V+ + +LVEFYAPWCGHCKSLAP Y K AT +E+ Sbjct: 141 QNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEE 192 Score = 62.5 bits (145), Expect = 3e-10 Identities = 35/75 (46%), Positives = 47/75 (62%), Gaps = 2/75 (2%) Frame = +2 Query: 47 IFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 226 I+ ALL L L V ++V+VL+ +FE + + LVEFYAPWCGHCK LAPEY Sbjct: 6 IWFGFALLALLLVSAVA--DDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEYE 63 Query: 227 K--AATKLAEEDLLS 265 K A+ K A+ L++ Sbjct: 64 KLGASFKKAKSVLIA 78 Score = 56.8 bits (131), Expect = 1e-08 Identities = 26/57 (45%), Positives = 37/57 (64%), Gaps = 2/57 (3%) Frame = +1 Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDIISWLKKKTG 426 + +A +DA + L E YGV G+PTLKFF N + DY GGR DD +S++ +K+G Sbjct: 194 VVIANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINEKSG 250 Score = 48.0 bits (109), Expect = 7e-06 Identities = 21/57 (36%), Positives = 35/57 (61%), Gaps = 2/57 (3%) Frame = +1 Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKTG 426 + +AKVD +++ + YGV GYPT+++F GS P Y G R A+ + ++ K+ G Sbjct: 75 VLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVNKEGG 131 >At2g47470.1 68415.m05925 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 361 Score = 67.7 bits (158), Expect = 8e-12 Identities = 30/52 (57%), Positives = 38/52 (73%), Gaps = 1/52 (1%) Frame = +2 Query: 104 ENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256 +NV+VL+ NF E V+ + +LVEFYAPWCGHCKSLAP Y K AT +E+ Sbjct: 141 QNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEE 192 Score = 62.5 bits (145), Expect = 3e-10 Identities = 35/75 (46%), Positives = 47/75 (62%), Gaps = 2/75 (2%) Frame = +2 Query: 47 IFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 226 I+ ALL L L V ++V+VL+ +FE + + LVEFYAPWCGHCK LAPEY Sbjct: 6 IWFGFALLALLLVSAVA--DDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEYE 63 Query: 227 K--AATKLAEEDLLS 265 K A+ K A+ L++ Sbjct: 64 KLGASFKKAKSVLIA 78 Score = 56.8 bits (131), Expect = 1e-08 Identities = 26/57 (45%), Positives = 37/57 (64%), Gaps = 2/57 (3%) Frame = +1 Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDIISWLKKKTG 426 + +A +DA + L E YGV G+PTLKFF N + DY GGR DD +S++ +K+G Sbjct: 194 VVIANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINEKSG 250 Score = 48.0 bits (109), Expect = 7e-06 Identities = 21/57 (36%), Positives = 35/57 (61%), Gaps = 2/57 (3%) Frame = +1 Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKTG 426 + +AKVD +++ + YGV GYPT+++F GS P Y G R A+ + ++ K+ G Sbjct: 75 VLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVNKEGG 131 >At3g16110.1 68416.m02035 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 534 Score = 63.3 bits (147), Expect = 2e-10 Identities = 24/84 (28%), Positives = 49/84 (58%) Frame = +1 Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPA 435 S + +AK+D + +A ++G+PTL F NG+ Y+GG +++I+ W++KKTG Sbjct: 126 SSVLMAKIDGERYSKVASQLEIKGFPTLLLFVNGTSQSYTGGFSSEEIVIWVQKKTGAST 185 Query: 436 VEVTSAEQAKELIDANTVIVFGFF 507 +++ + ++A + + + G F Sbjct: 186 IKLDTVDEASGFLKKHHTFILGLF 209 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/47 (42%), Positives = 28/47 (59%) Frame = +2 Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250 V+ L+ N + +I EY++V YAPWC L P +A+AAT L E Sbjct: 77 VVELNGDNTKRLIDGNEYVMVLGYAPWCARSAELMPRFAEAATDLKE 123 >At1g35620.1 68414.m04425 thioredoxin family protein similar to SP|Q43116 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Ricinus communis}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 61.7 bits (143), Expect = 5e-10 Identities = 27/55 (49%), Positives = 37/55 (67%) Frame = +2 Query: 86 DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250 D+ + VL L+ +NF++ I+T + I V+FYAPWCGHCK L PE AA LA+ Sbjct: 26 DQFTLDGTVLELTDSNFDSAISTFDCIFVDFYAPWCGHCKRLNPELDAAAPILAK 80 Score = 54.8 bits (126), Expect = 6e-08 Identities = 27/79 (34%), Positives = 44/79 (55%), Gaps = 1/79 (1%) Frame = +1 Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPP 432 + PI +AK++A + LA + +PTL + +G P++Y G R+AD ++ +LKK P Sbjct: 82 KQPIVIAKLNADKYSRLARKIEIDAFPTLMLYNHGVPMEYYGPRKADLLVRYLKKFVAPD 141 Query: 433 AVEVTSAEQAKELI-DANT 486 + S KE + DA T Sbjct: 142 VAVLESDSTVKEFVEDAGT 160 >At1g04980.1 68414.m00497 thioredoxin family protein similar to SP|Q63081 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Rattus norvegicus}; contains Pfam profile PF00085: Thioredoxin Length = 443 Score = 58.4 bits (135), Expect = 5e-09 Identities = 23/43 (53%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = +2 Query: 119 LSKANFETVITTTEYI-LVEFYAPWCGHCKSLAPEYAKAATKL 244 L+ +NF+ ++T ++ + +VEF+APWCGHCK LAPE+ KAA L Sbjct: 168 LNSSNFDELVTESKELWIVEFFAPWCGHCKKLAPEWKKAANNL 210 Score = 54.8 bits (126), Expect = 6e-08 Identities = 23/46 (50%), Positives = 34/46 (73%), Gaps = 1/46 (2%) Frame = +2 Query: 110 VLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244 VL L+ +NF++ V+ + +LVEF+APWCGHC+SL P + K A+ L Sbjct: 30 VLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQSLTPTWEKVASTL 75 Score = 47.6 bits (108), Expect = 9e-06 Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Frame = +1 Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNGS-PIDYSGGRQADDIISWLKKK 420 +A +DA + +++ YGVRG+PT+K F G PIDY G R A I + K+ Sbjct: 81 VAAIDADAHKSVSQDYGVRGFPTIKVFVPGKPPIDYQGARDAKSISQFAIKQ 132 Score = 39.1 bits (87), Expect = 0.003 Identities = 25/91 (27%), Positives = 43/91 (47%), Gaps = 7/91 (7%) Frame = +1 Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRN--GSPIDYSGGRQADDIISW----LK 414 + +KL V+ EQ + + V+G+PT+ F + SP+ Y G R A I S+ L+ Sbjct: 211 KGKVKLGHVNCDAEQSIKSRFKVQGFPTILVFGSDKSSPVPYEGARSASAIESFALEQLE 270 Query: 415 KKTGPPAV-EVTSAEQAKELIDANTVIVFGF 504 GP V E+T + ++ + + F Sbjct: 271 SNAGPAEVTELTGPDVMEDKCGSAAICFVSF 301 >At2g32920.1 68415.m04036 thioredoxin family protein similar to SP|Q15084 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Homo sapiens}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 56.0 bits (129), Expect = 2e-08 Identities = 24/43 (55%), Positives = 32/43 (74%), Gaps = 1/43 (2%) Frame = +2 Query: 119 LSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244 L+ +NF+ VI + E +VEF+APWCGHCK LAPE+ +AA L Sbjct: 167 LNASNFDDLVIESNELWIVEFFAPWCGHCKKLAPEWKRAAKNL 209 Score = 52.8 bits (121), Expect = 2e-07 Identities = 22/46 (47%), Positives = 33/46 (71%), Gaps = 1/46 (2%) Frame = +2 Query: 110 VLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244 V+ L+ +NF++ V+ + +LVEF+APWCGHCK+L P + K A L Sbjct: 32 VVQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKVANIL 77 Score = 49.6 bits (113), Expect = 2e-06 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 1/52 (1%) Frame = +1 Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISWLKKK 420 +A +DA Q A+ YG++G+PT+K F G +PIDY G R A I ++ K+ Sbjct: 83 VAAIDADAHQSAAQDYGIKGFPTIKVFVPGKAPIDYQGARDAKSIANFAYKQ 134 Score = 35.5 bits (78), Expect = 0.038 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 4/66 (6%) Frame = +1 Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDIISWLKK--KTGP 429 +KL V+ EQ + + V+G+PT+ F SP Y G R A I S+ + ++ Sbjct: 213 VKLGHVNCDVEQSIMSRFKVQGFPTILVFGPDKSSPYPYEGARSASAIESFASELVESSA 272 Query: 430 PAVEVT 447 VEVT Sbjct: 273 GPVEVT 278 >At4g27080.1 68417.m03893 thioredoxin family protein contains Pfam PF00085: Thioredoxin Length = 480 Score = 46.0 bits (104), Expect = 3e-05 Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 2/58 (3%) Frame = +2 Query: 83 GDEVPTE--ENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250 GDE E E+ + L+ NF+T ++V FYAPWC C L P + KAA ++ E Sbjct: 132 GDETGEEIVEDSVPLTGRNFDTFTHQFPILVVNFYAPWCYWCNLLKPSWEKAAKQIKE 189 Score = 41.1 bits (92), Expect = 8e-04 Identities = 17/33 (51%), Positives = 23/33 (69%) Frame = +1 Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI 366 LAKVD TQE DL ++GYP+++ FR GS + Sbjct: 201 LAKVDCTQEGDLCRRNHIQGYPSIRIFRKGSDL 233 >At2g01270.1 68415.m00040 thioredoxin family protein low similarity to quiescin [Homo sapiens] GI:13257405; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 495 Score = 41.9 bits (94), Expect = 4e-04 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 2/47 (4%) Frame = +2 Query: 101 EENVLVLSKANFETVI--TTTEYILVEFYAPWCGHCKSLAPEYAKAA 235 ++ + L+ NF++V+ T +Y +VEF+A WC C++ P Y K A Sbjct: 34 KDKAVELNTTNFDSVLKDTPAKYAVVEFFAHWCPACRNYKPHYEKVA 80 >At1g15020.2 68414.m01795 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 528 Score = 41.1 bits (92), Expect = 8e-04 Identities = 16/47 (34%), Positives = 29/47 (61%), Gaps = 2/47 (4%) Frame = +2 Query: 101 EENVLVLSKANFETVI--TTTEYILVEFYAPWCGHCKSLAPEYAKAA 235 ++N + L+ NF++V + +Y ++EF+A WC C++ P Y K A Sbjct: 40 KDNAIELNATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKPHYEKVA 86 >At1g15020.1 68414.m01794 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 502 Score = 41.1 bits (92), Expect = 8e-04 Identities = 16/47 (34%), Positives = 29/47 (61%), Gaps = 2/47 (4%) Frame = +2 Query: 101 EENVLVLSKANFETVI--TTTEYILVEFYAPWCGHCKSLAPEYAKAA 235 ++N + L+ NF++V + +Y ++EF+A WC C++ P Y K A Sbjct: 40 KDNAIELNATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKPHYEKVA 86 >At1g62180.1 68414.m07014 5'-adenylylsulfate reductase 2, chloroplast (APR2) (APSR) / adenosine 5'-phosphosulfate 5'-adenylylsulfate (APS) sulfotransferase 2 / 3'-phosphoadenosine-5'-phosphosulfate (PAPS) reductase homolog 43 (PRH-43) identical to SP|P92981 5'-adenylylsulfate reductase 2, chloroplast precursor (EC 1.8.4.9) (Adenosine 5'-phosphosulfate 5'-adenylylsulfate sulfotransferase 2) (APS sulfotransferase 2) (Thioredoxin independent APS reductase 2) (3'-phosphoadenosine-5'-phosphosulfate reductase homolog 43) (PAPS reductase homolog 43) (Prh-43) {Arabidopsis thaliana}; identical to cDNA PAPS reductase homolog (PRH43) GI:1710115 Length = 454 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Frame = +2 Query: 89 EVPTEENVLVLSKANFETVI---TTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 247 E+ NV+ LSK E ++ E LV YAPWC C+++ Y + A KLA Sbjct: 337 EIFESNNVVALSKGGVENLLKLENRKEAWLVVLYAPWCPFCQAMEASYIELAEKLA 392 >At4g37200.1 68417.m05266 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; identical to cDNA thioredoxin-like protein (hcf164 gene) GI;12049652 Length = 261 Score = 39.9 bits (89), Expect = 0.002 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 2/70 (2%) Frame = +2 Query: 26 NIEMRVLIFTAIALLGLALGDEVPTEENV--LVLSKANFETVITTTEYILVEFYAPWCGH 199 +I RV T IA L L + + ++ L S +E ++ + +VEFYA WC Sbjct: 93 DINRRVAAVTVIAALSLFVSTRLDFGISLKDLTASALPYEEALSNGKPTVVEFYADWCEV 152 Query: 200 CKSLAPEYAK 229 C+ LAP+ K Sbjct: 153 CRELAPDVYK 162 >At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 148 Score = 38.3 bits (85), Expect = 0.005 Identities = 14/46 (30%), Positives = 26/46 (56%) Frame = +2 Query: 125 KANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLL 262 K+ + T + +++EF A WCG CK+L P+ + A K + + + Sbjct: 49 KSRLNALKDTNKLLVIEFTAKWCGPCKTLEPKLEELAAKYTDVEFV 94 >At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-M1) nearly identical to SP|O48737 Thioredoxin M-type 1, chloroplast precursor (TRX-M1) {Arabidopsis thaliana}; similar to ESTs gb|T13714, gb|H76398, gb|N37762, gb|AA042639, gb|T21104, emb|Z30901 Length = 179 Score = 38.3 bits (85), Expect = 0.005 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 1/51 (1%) Frame = +2 Query: 98 TEENVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 247 T + V++ + +++ V+ E + V+F+APWCG CK + P + A K A Sbjct: 72 TATGIPVVNDSTWDSLVLKADEPVFVDFWAPWCGPCKMIDPIVNELAQKYA 122 Score = 27.5 bits (58), Expect = 10.0 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = +1 Query: 265 KLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIIS 405 K K++ + YGVR PT+ F NG D G + D ++ Sbjct: 126 KFYKLNTDESPATPGQYGVRSIPTIMIFVNGEKKDTIIGAVSKDTLA 172 >At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 129 Score = 37.5 bits (83), Expect = 0.009 Identities = 13/42 (30%), Positives = 28/42 (66%) Frame = +2 Query: 125 KANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250 K+ F+++ + + ++++F A WCG CK++ P + A+K +E Sbjct: 33 KSLFDSMKGSNKLLVIDFTAVWCGPCKAMEPRVREIASKYSE 74 >At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / PAPS reductase homolog (PRH19) identical to 5'-adenylylsulfate reductase [Arabidopsis thaliana] GI:2738756; identical to cDNA PAPS reductase homolog (PRH19) GI:1710111 Length = 465 Score = 37.1 bits (82), Expect = 0.012 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 3/51 (5%) Frame = +2 Query: 104 ENVLVLSKANFETVI---TTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 247 EN++ LS+ E ++ E +V YAPWC C+++ Y + A KLA Sbjct: 353 ENLVTLSRQGIENLMKLENRKEPWIVVLYAPWCPFCQAMEASYDELADKLA 403 >At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-M2) nearly identical to SP|Q9SEU8 Thioredoxin M-type 2, chloroplast precursor (TRX-M2) {Arabidopsis thaliana} Length = 186 Score = 37.1 bits (82), Expect = 0.012 Identities = 14/41 (34%), Positives = 28/41 (68%), Gaps = 1/41 (2%) Frame = +2 Query: 98 TEENVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAP 217 T ++ V++ + +++ V+ T ++V+F+APWCG CK + P Sbjct: 78 TTTDIQVVNDSTWDSLVLKATGPVVVDFWAPWCGPCKMIDP 118 >At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-M4) nearly identical to SP|Q9SEU6 Thioredoxin M-type 4, chloroplast precursor (TRX-M4) {Arabidopsis thaliana} Length = 193 Score = 37.1 bits (82), Expect = 0.012 Identities = 14/34 (41%), Positives = 24/34 (70%), Gaps = 1/34 (2%) Frame = +2 Query: 119 LSKANFETVITTTEY-ILVEFYAPWCGHCKSLAP 217 LS + ++T + ++ +LVEF+APWCG C+ + P Sbjct: 91 LSDSEWQTKVLESDVPVLVEFWAPWCGPCRMIHP 124 Score = 28.7 bits (61), Expect = 4.3 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 265 KLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID 369 K K++ + + A YG+R PT+ F+ G D Sbjct: 138 KFYKINTDESPNTANRYGIRSVPTVIIFKGGEKKD 172 >At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) identical to SP|Q39239 Thioredoxin H-type 4 (TRX-H-4) {Arabidopsis thaliana} Length = 119 Score = 37.1 bits (82), Expect = 0.012 Identities = 17/51 (33%), Positives = 27/51 (52%) Frame = +1 Query: 274 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 426 KVD + Q +A+ +GV PT F + G +D G +D+ + + K TG Sbjct: 65 KVDVDELQSVAKEFGVEAMPTFVFIKAGEVVDKLVGANKEDLQAKIVKHTG 115 Score = 28.7 bits (61), Expect = 4.3 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +2 Query: 152 TTEYILVEFYAPWCGHCKSLAPEYAKAATK 241 + + I+++F A WC C+ +AP + A K Sbjct: 27 SNKLIVIDFTASWCPPCRMIAPIFNDLAKK 56 >At3g20560.1 68416.m02603 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 483 Score = 36.7 bits (81), Expect = 0.016 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +2 Query: 53 TAIALLGLALGDEVPTE--ENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 226 + +AL + G+E E + + L+ A+FE + ++V F APWC L P + Sbjct: 122 SGLALHNINHGEETKEEFPDGAIPLTSASFEALSHHFPILVVNFNAPWCYWSNRLKPSWE 181 Query: 227 KAA 235 KAA Sbjct: 182 KAA 184 Score = 35.5 bits (78), Expect = 0.038 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 10/66 (15%) Frame = +1 Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI----------DYSGGRQADDIISWL 411 + L VD T+E L + ++GYP+++ FR GS + Y G R D I+ + Sbjct: 199 VLLGNVDCTEEPALCKRNHIQGYPSIRIFRKGSDLREDHGHHEHESYYGDRDTDSIVKMV 258 Query: 412 KKKTGP 429 + P Sbjct: 259 EGLVAP 264 >At1g50950.1 68414.m05728 thioredoxin-related contains weak hit to Pfam PF00085: Thioredoxin; contains 2 predicted transmembrane domains Length = 484 Score = 36.7 bits (81), Expect = 0.016 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 10/66 (15%) Frame = +1 Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI----------DYSGGRQADDIISWL 411 + L VD T+E L +S ++GYP+++ FR GS + Y G R D ++ + Sbjct: 200 VLLGSVDCTEEPTLCKSNHIQGYPSIRIFRRGSGLREDHGNHEHESYYGDRDTDSLVKMV 259 Query: 412 KKKTGP 429 ++ P Sbjct: 260 EELLKP 265 Score = 33.9 bits (74), Expect = 0.12 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +2 Query: 119 LSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 235 L+ A FE + ++V FYAPWC L P + KA+ Sbjct: 147 LTGAAFEKFTHHFQILVVNFYAPWCYWSNRLKPSWVKAS 185 >At5g61440.1 68418.m07709 thioredoxin family protein low similarity to thioredoxin [Callithrix jacchus] GI:13560979; contains Pfam profile: PF00085 Thioredoxin Length = 245 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 3/52 (5%) Frame = +2 Query: 89 EVPTEENVLVLSKANF--ETVITTTEYILV-EFYAPWCGHCKSLAPEYAKAA 235 E T N+L + AN ++++ + ++V +FY+P CG CKSL P+ + A Sbjct: 80 EKSTNHNMLEIQSANHLVDSLLNAGDRLVVLDFYSPGCGGCKSLHPKICQLA 131 >At4g04950.1 68417.m00719 thioredoxin family protein similar to PKCq-interacting protein PICOT from [Mus musculus] GI:6840949, [Rattus norvegicus] GI:6840951; contains Pfam profile PF00085: Thioredoxin Length = 488 Score = 35.9 bits (79), Expect = 0.029 Identities = 23/63 (36%), Positives = 33/63 (52%) Frame = +1 Query: 274 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSA 453 +V+A + +++E+Y V P FF++G +D G AD S L K G A TSA Sbjct: 57 RVEAEEHPEISEAYSVAAVPYFVFFKDGKTVDTLEG--ADP--SSLANKVGKVAGSSTSA 112 Query: 454 EQA 462 E A Sbjct: 113 EPA 115 >At1g34780.1 68414.m04329 protein disulfide isomerase-related contains weak similarity to Pfam:P08003 protein disulfide isomerase A4 precursor (Protein ERp-72, ERp72) [Mus musculus] Length = 310 Score = 35.9 bits (79), Expect = 0.029 Identities = 16/50 (32%), Positives = 26/50 (52%) Frame = +1 Query: 313 YGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQA 462 YGV G+PTL + Y G R D ++++ TG ++ TS E++ Sbjct: 131 YGVHGFPTLLLLNSTMRARYRGTRMLDSLVAFYSDVTGIETLDKTSLERS 180 >At4g21990.1 68417.m03183 5'-adenylylsulfate reductase (APR3) / PAPS reductase homolog (PRH26) identical to 5'-adenylylsulfate reductase [Arabidopsis thaliana] GI:2738760; identical to cDNA PAPS reductase homolog (PRH26) GI:1710113 Length = 458 Score = 35.5 bits (78), Expect = 0.038 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 3/61 (4%) Frame = +2 Query: 71 GLALGDEVPTEENVLVLSKANFETVI---TTTEYILVEFYAPWCGHCKSLAPEYAKAATK 241 G A ++ ENV+ LS+ E ++ E +V YAPWC C+++ + + A K Sbjct: 335 GTASVADIFNSENVVNLSRQGIENLMKLENRKEAWIVVLYAPWCPFCQAMEASFDELADK 394 Query: 242 L 244 L Sbjct: 395 L 395 >At2g33270.1 68415.m04078 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 273 Score = 35.5 bits (78), Expect = 0.038 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = +2 Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLL 262 ++V+F++P CG CK+L P+ K A K E + L Sbjct: 116 VVVDFFSPSCGGCKALHPKICKIAEKNPEVEFL 148 >At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identical to SP|P29448 Thioredoxin H-type 1 (TRX-H-1) {Arabidopsis thaliana} Length = 114 Score = 35.1 bits (77), Expect = 0.050 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +2 Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATKL 244 ++V+F A WCG C+ +AP +A A KL Sbjct: 31 VVVDFTASWCGPCRFIAPFFADLAKKL 57 Score = 31.1 bits (67), Expect = 0.81 Identities = 13/48 (27%), Positives = 25/48 (52%) Frame = +1 Query: 274 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKK 417 KVD + + +A + ++ PT F + G +D G + D++ S + K Sbjct: 64 KVDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTIAK 111 >At1g50320.1 68414.m05641 thioredoxin x nearly identical to thioredoxin x GB:AAF15952 GI:6539616 from [Arabidopsis thaliana] Length = 182 Score = 35.1 bits (77), Expect = 0.050 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +2 Query: 140 TVITTTEYILVEFYAPWCGHCKSLAP 217 TV+ + + +LVEF A WCG CK + P Sbjct: 82 TVLESAQPVLVEFVATWCGPCKLIYP 107 >At4g29670.2 68417.m04227 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 236 Score = 34.7 bits (76), Expect = 0.066 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATK 241 ++VEFY WC C++L P+ K A + Sbjct: 126 VIVEFYGTWCASCRALFPKLCKTAVE 151 >At4g29670.1 68417.m04226 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 235 Score = 34.7 bits (76), Expect = 0.066 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATK 241 ++VEFY WC C++L P+ K A + Sbjct: 126 VIVEFYGTWCASCRALFPKLCKTAVE 151 >At4g26160.1 68417.m03765 thioredoxin family protein low similarity to thioredoxin [Ictalurus punctatus] GI:9837585; contains Pfam profile: PF00085 Thioredoxin Length = 221 Score = 34.7 bits (76), Expect = 0.066 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +2 Query: 164 ILVEFYAPWCGHCKSLAPEYAKAA 235 ++V+FY WCG C+++ P+ K A Sbjct: 116 VIVDFYGTWCGSCRAMFPKLCKTA 139 Score = 29.1 bits (62), Expect = 3.3 Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 2/38 (5%) Frame = +1 Query: 406 WLKKKTGPPAVEVTSAEQ-AKELIDA-NTVIVFGFFWT 513 W ++K GP +++TSAEQ L DA + +++ F+ T Sbjct: 86 WWERKAGPNMIDITSAEQFLNALKDAGDRLVIVDFYGT 123 >At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 185 Score = 33.9 bits (74), Expect = 0.12 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +2 Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATK 241 ++++ Y WCG CK +AP+Y + + K Sbjct: 100 VVLDMYTQWCGPCKVIAPKYKELSEK 125 >At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 178 Score = 33.1 bits (72), Expect = 0.20 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +2 Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATK 241 ++++ Y WCG CK +AP+Y + K Sbjct: 90 VVLDMYTQWCGPCKVIAPKYKALSEK 115 >At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) identical to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; identical to cDNA (Gif2) mRNA for thioredoxin GI:992963 Length = 133 Score = 32.7 bits (71), Expect = 0.27 Identities = 12/44 (27%), Positives = 23/44 (52%) Frame = +2 Query: 131 NFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLL 262 +F + + + ++V+F A WCG C+ + P A K + D + Sbjct: 39 HFNEIKESNKLLVVDFSASWCGPCRMIEPAIHAMADKFNDVDFV 82 >At3g19780.1 68416.m02504 expressed protein Length = 1014 Score = 32.7 bits (71), Expect = 0.27 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +2 Query: 116 VLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLL 262 +L++ NF + I ++L+ PWCG +SL E + + E LL Sbjct: 29 ILTEQNFSSQIRLHPHVLLFVTTPWCGESRSLKYEITQMVQRREEFGLL 77 >At1g76760.1 68414.m08933 thioredoxin family protein similar to thioredoxin CH2, M-type, chloroplast precursor GB:P23400 SP|P23400 [Chlamydomonas reinhardtii]; contains Pfam profile: PF00085 Thioredoxin Length = 172 Score = 32.7 bits (71), Expect = 0.27 Identities = 11/30 (36%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Frame = +2 Query: 131 NFETVITTTEY-ILVEFYAPWCGHCKSLAP 217 +FE ++ ++ +LV++YA WCG C+ + P Sbjct: 72 SFEDLLVNSDKPVLVDYYATWCGPCQFMVP 101 Score = 32.7 bits (71), Expect = 0.27 Identities = 14/51 (27%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +1 Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDII 402 + I++ K+D + +A Y + PT F++G P D + G A +I Sbjct: 111 KDKIQVVKIDTEKYPSIANKYKIEALPTFILFKDGEPCDRFEGALTAKQLI 161 >At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) identical to SP|Q39241 Thioredoxin H-type 5 (TRX-H-5) {Arabidopsis thaliana}; identical to cDNA (TOUL) mRNA for thioredoxin GI:992965 Length = 118 Score = 32.7 bits (71), Expect = 0.27 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = +1 Query: 274 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 426 K+D + Q +A+ + V PT F + G+ ID G D+I L K G Sbjct: 63 KIDVDELQAVAQEFKVEAMPTFVFMKEGNIIDRVVGAAKDEINEKLMKHGG 113 Score = 31.5 bits (68), Expect = 0.61 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = +2 Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATK 241 I+++F A WC C+ +AP +A+ A K Sbjct: 30 IVIDFTASWCPPCRFIAPVFAEMAKK 55 >At1g43560.1 68414.m05000 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to thioredoxin GI:142153 from [Synechococcus PCC6301] Length = 167 Score = 32.3 bits (70), Expect = 0.35 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +2 Query: 164 ILVEFYAPWCGHCKSLAP 217 +LV+FYA WCG C+ + P Sbjct: 79 VLVDFYATWCGPCQLMVP 96 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/48 (27%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +1 Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDII 402 I + K+D + LA Y + PT F++G D + G A+ ++ Sbjct: 109 IAVVKIDTEKYPSLANKYQIEALPTFILFKDGKLWDRFEGALPANQLV 156 >At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to tetratricoredoxin [Arabidopsis thaliana] GI:18041544; similar to SP|Q42443 Thioredoxin H-type (TRX-H) (Phloem sap 13 kDa protein-1) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 380 Score = 31.5 bits (68), Expect = 0.61 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +1 Query: 250 RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID 369 + S + KVD + D+A S+ + PT F R+G +D Sbjct: 320 QHSRVVFLKVDIDKANDVAASWNISSVPTFCFIRDGKEVD 359 Score = 31.1 bits (67), Expect = 0.81 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +2 Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATK 241 +++ F A WCG C+ ++P Y+ AT+ Sbjct: 295 LILYFTATWCGPCRYMSPLYSNLATQ 320 >At4g32580.1 68417.m04638 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 160 Score = 31.1 bits (67), Expect = 0.81 Identities = 20/60 (33%), Positives = 31/60 (51%) Frame = +1 Query: 274 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSA 453 +V+A + +++E+Y V P FF++G +D G AD S L K G A +T A Sbjct: 57 RVEAEEHPEISEAYSVALVPYFVFFKDGKTVDTLEG--ADP--SSLANKVGKVAGSITPA 112 >At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-M3) identical to SP|Q9SEU7 Thioredoxin M-type 3, chloroplast precursor (TRX-M3) {Arabidopsis thaliana} Length = 173 Score = 31.1 bits (67), Expect = 0.81 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +2 Query: 137 ETVITTTEYILVEFYAPWCGHCK 205 ++V+ + +LVEFY WCG C+ Sbjct: 78 DSVLKSETPVLVEFYTSWCGPCR 100 >At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) identical to SP|Q42403 Thioredoxin H-type 3 (TRX-H-3) {Arabidopsis thaliana}; identical to cDNA (GIF1) mRNA for thioredoxin GI:992961 Length = 118 Score = 30.7 bits (66), Expect = 1.1 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATK 241 I+++F A WC C+ +AP +A A K Sbjct: 30 IVIDFTATWCPPCRFIAPVFADLAKK 55 Score = 28.7 bits (61), Expect = 4.3 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +1 Query: 274 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKK 417 KVD + +AE + V+ PT F + G + G ++II+ L+K Sbjct: 63 KVDVDELNTVAEEFKVQAMPTFIFMKEGEIKETVVGAAKEEIIANLEK 110 >At4g08930.1 68417.m01470 thioredoxin-related contains weak similarity to Swiss-Prot:Q39239 thioredoxin H-type 4 (TRX-H-4). [Mouse-ear cress] Length = 295 Score = 30.7 bits (66), Expect = 1.1 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 313 YGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 426 YGV G+PT+ + + Y G R D ++++ TG Sbjct: 124 YGVHGFPTIILMNSTMLVVYRGSRTLDSLVAFYTDVTG 161 >At3g06730.1 68416.m00798 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 183 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +2 Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATK 241 ++V+FYA WCG C +A E A + Sbjct: 97 LIVDFYATWCGPCILMAQELEMLAVE 122 >At1g08570.1 68414.m00950 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to ESTs gb|T46281, gb|R83933, gb|N65879, emb|F14466, gb|N96726, gb|AA042340, and emb|Z18150 Length = 275 Score = 30.3 bits (65), Expect = 1.4 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 164 ILVEFYAPWCGHCKSLAPEYAKAA 235 ++V+F++P CG CK+L P+ + A Sbjct: 120 VVVDFFSPGCGGCKALHPKICQFA 143 >At1g07960.3 68414.m00867 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 29.9 bits (64), Expect = 1.9 Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 1/71 (1%) Frame = +1 Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAV 438 I++ +VD + + + YPT F NG + Y G R + + +++ ++T A Sbjct: 78 IEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVVEET-EKAA 136 Query: 439 EVTSAEQAKEL 471 E E KEL Sbjct: 137 EKAQLED-KEL 146 Score = 28.7 bits (61), Expect = 4.3 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +2 Query: 110 VLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSL 211 V+ L+ F I + V+F PWC HCK L Sbjct: 27 VITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61 >At1g07960.2 68414.m00866 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 29.9 bits (64), Expect = 1.9 Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 1/71 (1%) Frame = +1 Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAV 438 I++ +VD + + + YPT F NG + Y G R + + +++ ++T A Sbjct: 78 IEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVVEET-EKAA 136 Query: 439 EVTSAEQAKEL 471 E E KEL Sbjct: 137 EKAQLED-KEL 146 Score = 28.7 bits (61), Expect = 4.3 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +2 Query: 110 VLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSL 211 V+ L+ F I + V+F PWC HCK L Sbjct: 27 VITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61 >At1g07960.1 68414.m00865 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 29.9 bits (64), Expect = 1.9 Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 1/71 (1%) Frame = +1 Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAV 438 I++ +VD + + + YPT F NG + Y G R + + +++ ++T A Sbjct: 78 IEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVVEET-EKAA 136 Query: 439 EVTSAEQAKEL 471 E E KEL Sbjct: 137 EKAQLED-KEL 146 Score = 28.7 bits (61), Expect = 4.3 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +2 Query: 110 VLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSL 211 V+ L+ F I + V+F PWC HCK L Sbjct: 27 VITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61 >At3g08710.1 68416.m01012 thioredoxin family protein similar to thioredoxin H-type GB:P29448 SP|P29448 [Arabidopsis thaliana], Thioredoxin H-type 2 (TRX-H2) SP|Q07090 {Nicotiana tabacum}; contains Pfam profile: PF00085 Thioredoxin Length = 140 Score = 29.5 bits (63), Expect = 2.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATK 241 ++ F A WCG CK +AP + + + K Sbjct: 48 VVANFSATWCGPCKIVAPFFIELSEK 73 Score = 27.5 bits (58), Expect = 10.0 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +1 Query: 250 RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI 366 + S + VD + D + S+ ++ PT F +NG I Sbjct: 73 KHSSLMFLLVDVDELSDFSSSWDIKATPTFFFLKNGQQI 111 >At1g52990.1 68414.m05997 thioredoxin family protein similar to SP|P48384 Thioredoxin M-type, chloroplast precursor (TRX-M) {Pisum sativum}; contains Pfam profile PF00085: Thioredoxin Length = 313 Score = 29.5 bits (63), Expect = 2.5 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +2 Query: 155 TEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253 T +++V F A WCG C+ + P K ++ E Sbjct: 227 TPHVMVMFTARWCGPCRDMIPILNKMDSEYKNE 259 >At2g24610.1 68415.m02940 cyclic nucleotide-regulated ion channel, putative (CNGC14) similar to cyclic nucleotide and calmodulin-regulated ion channel (GI:4581205) [Arabidopsis thaliana] Length = 726 Score = 28.7 bits (61), Expect = 4.3 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = +3 Query: 480 QYCYCIWFLLDQSSARAKTFLSTAQVVDDQVFAIV 584 +Y YC+WF L S+ + LST+ V + +FAI+ Sbjct: 349 KYLYCLWFGLQNLSSYGQN-LSTSTSVLETMFAIL 382 >At1g49900.1 68414.m05596 zinc finger (C2H2 type) family protein contains Pfam profile: PF00096 zinc finger, C2H2 type Length = 917 Score = 28.3 bits (60), Expect = 5.7 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +3 Query: 585 SDEKVIKELEAEDEDVVLFKNFEEKRVKYEDEE 683 SD ++ + E+ED VLF+ + + R+K D E Sbjct: 520 SDHGNVESIRLEEEDAVLFEPWLKSRLKSRDRE 552 >At1g11530.1 68414.m01324 thioredoxin family protein similar to thioredoxin H-type from Arabidopsis thaliana SP|P29448, Nicotiana tabacum SP|Q07090; contains Pfam profile: PF00085 Thioredoxin Length = 118 Score = 28.3 bits (60), Expect = 5.7 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +1 Query: 277 VDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDI 399 VD + +++A V+ PT F ++G+ +D G D+I Sbjct: 61 VDVDEVKEVASQLEVKAMPTFLFLKDGNAMDKLVGANPDEI 101 >At5g35910.1 68418.m04312 3'-5' exonuclease domain-containing protein / helicase and RNase D C-terminal domain-containing protein / HRDC domain-containing protein low similarity to SP|Q01780 Polymyositis/scleroderma autoantigen 2 {Homo sapiens}; contains Pfam profiles PF00570: HRDC domain, PF01612: 3'-5' exonuclease Length = 838 Score = 27.9 bits (59), Expect = 7.6 Identities = 18/54 (33%), Positives = 30/54 (55%) Frame = +3 Query: 582 VSDEKVIKELEAEDEDVVLFKNFEEKRVKYEDEEITEDLLNAGCLXRACLLSLN 743 VS+ KV +E D++L +N +EK+V EDE ++ L+ + C S+N Sbjct: 713 VSESKVSS---SEMGDIILLENGDEKKVDAEDEPMSLSELSTN--FQKCFKSMN 761 >At4g30360.1 68417.m04314 cyclic nucleotide-regulated ion channel, putative (CNGC17) similar to cyclic nucleotide and calmodulin-regulated ion channel cngc5 GI:4581205 from [Arabidopsis thaliana] Length = 720 Score = 27.9 bits (59), Expect = 7.6 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +3 Query: 480 QYCYCIWFLLDQSSARAKTFLSTAQVVDDQVFAIV 584 +Y YC+W+ L Q S+ + LST + + FA++ Sbjct: 349 RYFYCLWWGLQQLSSYGQN-LSTTMFMGETTFAVL 382 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 27.9 bits (59), Expect = 7.6 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -3 Query: 476 SISSLACSAEVTSTAGGPVFFFSQLMMSSA*RPP 375 S ++ AC +S+ GGP +++ S + RPP Sbjct: 60 SPTTTACPPPPSSSGGGPYYYYPPASQSGSYRPP 93 >At1g15280.2 68414.m01829 glycine-rich protein Length = 585 Score = 27.9 bits (59), Expect = 7.6 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 2/61 (3%) Frame = +3 Query: 507 LDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDEDV--VLFKNFEEKRVKYEDE 680 L++S A + S DD V +++ + + + DE+V V + N E+ YED+ Sbjct: 15 LNRSLATRRREASDDDSDDDDAVRDVKNQRAVVDSDLSDEEVGTVKYDNDEDGEDSYEDD 74 Query: 681 E 683 E Sbjct: 75 E 75 >At1g15280.1 68414.m01828 glycine-rich protein Length = 584 Score = 27.9 bits (59), Expect = 7.6 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 2/61 (3%) Frame = +3 Query: 507 LDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDEDV--VLFKNFEEKRVKYEDE 680 L++S A + S DD V +++ + + + DE+V V + N E+ YED+ Sbjct: 15 LNRSLATRRREASDDDSDDDDAVRDVKNQRAVVDSDLSDEEVGTVKYDNDEDGEDSYEDD 74 Query: 681 E 683 E Sbjct: 75 E 75 >At5g64070.1 68418.m08046 phosphatidylinositol 4-kinase (PI4K) nearly identical to gi:4467359 Length = 1121 Score = 27.5 bits (58), Expect = 10.0 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +3 Query: 588 DEKVIKELEAEDEDVVLFKNFEEK 659 D+KV KE++ ED+D L K F EK Sbjct: 370 DDKVPKEVDDEDKDGFLKKLFREK 393 >At4g08710.1 68417.m01439 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 715 Score = 27.5 bits (58), Expect = 10.0 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +3 Query: 540 LSTAQVVDDQVFAIVSDEKVIKELEAEDEDV 632 L T QV+D V + ++K++K + E++DV Sbjct: 470 LGTTQVIDSIVTLGIEEQKLMKAITEEEDDV 500 >At3g61710.2 68416.m06916 autophagy protein Apg6 family contains weak similarity to Beclin 1 (Coiled-coil myosin-like BCL2-interacting protein) (Protein GT197) (Swiss-Prot:Q14457) [Homo sapiens]; contains Pfam profile PF04111: Autophagy protein Apg6 Length = 386 Score = 27.5 bits (58), Expect = 10.0 Identities = 13/42 (30%), Positives = 25/42 (59%) Frame = +3 Query: 558 VDDQVFAIVSDEKVIKELEAEDEDVVLFKNFEEKRVKYEDEE 683 V+D + + E ++ LE E +DV+ +F +++ K E+EE Sbjct: 187 VEDVTRDVEAYEACVQRLEGETQDVLSEADFLKEKKKIEEEE 228 >At3g61710.1 68416.m06915 autophagy protein Apg6 family contains weak similarity to Beclin 1 (Coiled-coil myosin-like BCL2-interacting protein) (Protein GT197) (Swiss-Prot:Q14457) [Homo sapiens]; contains Pfam profile PF04111: Autophagy protein Apg6 Length = 517 Score = 27.5 bits (58), Expect = 10.0 Identities = 13/42 (30%), Positives = 25/42 (59%) Frame = +3 Query: 558 VDDQVFAIVSDEKVIKELEAEDEDVVLFKNFEEKRVKYEDEE 683 V+D + + E ++ LE E +DV+ +F +++ K E+EE Sbjct: 187 VEDVTRDVEAYEACVQRLEGETQDVLSEADFLKEKKKIEEEE 228 >At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 691 Score = 27.5 bits (58), Expect = 10.0 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +1 Query: 277 VDATQEQDLAESYGVRGYPTLKFFRNGSPI 366 VD + LA++ +R PT K ++NG + Sbjct: 642 VDVEESMALAKAESIRKVPTFKMYKNGDKV 671 >At1g74250.1 68414.m08599 DNAJ heat shock N-terminal domain-containing protein contains Pfam domains PF00226: DnaJ domain and PF00096: Zinc finger, C2H2 type Length = 630 Score = 27.5 bits (58), Expect = 10.0 Identities = 20/62 (32%), Positives = 29/62 (46%), Gaps = 8/62 (12%) Frame = +3 Query: 531 KTFLSTAQVVDDQVFAIVSDEKVIKELEAEDEDVVLFKNF------EEKRV--KYEDEEI 686 K + A DD+ F D + E E ED+++ L K ++K V K EDE+ Sbjct: 387 KEVVGEADETDDEYFVAEEDMQGSSESEDEDDEMTLLKKMVSGQKNKQKNVVSKEEDEDE 446 Query: 687 TE 692 TE Sbjct: 447 TE 448 >At1g53300.1 68414.m06041 thioredoxin family protein contains Pfam profiles PF00085: Thioredoxin, PF00515: TPR Domain; similar to tetratricopeptide repeat protein 2 (GI:7248701) [Drosophila melanogaster]; similar to DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) (TPR repeat protein 2) (Swiss-Prot:Q99615) [Homo sapiens] Length = 699 Score = 27.5 bits (58), Expect = 10.0 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 250 RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI 366 R I KVD + + + VR PT+K ++NGS + Sbjct: 641 RYPSIHFLKVDIDKCPSIGNAENVRVVPTVKIYKNGSRV 679 >At1g07700.3 68414.m00829 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 217 Score = 27.5 bits (58), Expect = 10.0 Identities = 9/35 (25%), Positives = 19/35 (54%) Frame = +2 Query: 152 TTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256 T ++V+FY CG CK + ++K + +++ Sbjct: 119 TNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQE 153 >At1g07700.2 68414.m00827 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 171 Score = 27.5 bits (58), Expect = 10.0 Identities = 9/35 (25%), Positives = 19/35 (54%) Frame = +2 Query: 152 TTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256 T ++V+FY CG CK + ++K + +++ Sbjct: 106 TNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQE 140 >At1g07700.1 68414.m00828 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 204 Score = 27.5 bits (58), Expect = 10.0 Identities = 9/35 (25%), Positives = 19/35 (54%) Frame = +2 Query: 152 TTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256 T ++V+FY CG CK + ++K + +++ Sbjct: 106 TNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQE 140 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,866,234 Number of Sequences: 28952 Number of extensions: 295991 Number of successful extensions: 1101 Number of sequences better than 10.0: 75 Number of HSP's better than 10.0 without gapping: 1002 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1089 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1653386488 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -