BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30668.Seq (694 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 30 1.5 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 30 1.5 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_50729| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_23213| Best HMM Match : SH3_1 (HMM E-Value=9.2e-12) 29 4.7 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_30356| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 29 4.7 SB_742| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_36615| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 28 8.3 SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_14602| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) 28 8.3 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_58013| Best HMM Match : ABC_membrane (HMM E-Value=6.3e-28) 28 8.3 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 28 8.3 SB_46171| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_13869| Best HMM Match : Antirestrict (HMM E-Value=4.5) 28 8.3 SB_13618| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 30.3 bits (65), Expect = 1.5 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +1 Query: 1 LVDPPGCRNSARAI 42 LVDPPGCRNS R + Sbjct: 15 LVDPPGCRNSIRTV 28 >SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) Length = 205 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = +1 Query: 1 LVDPPGCRNSARAIIS 48 LVDPPGCRNS A +S Sbjct: 15 LVDPPGCRNSMNANVS 30 >SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +1 Query: 1 LVDPPGCRNSARA 39 LVDPPGCRNS R+ Sbjct: 15 LVDPPGCRNSIRS 27 >SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +1 Query: 1 LVDPPGCRNSARAIIS*YFI 60 LVDPPGCRNS I Y + Sbjct: 15 LVDPPGCRNSINTINHIYHV 34 >SB_50729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 50 YEIIARAEFLQPGGST 3 Y II+ EFLQPGGST Sbjct: 16 YNIISSIEFLQPGGST 31 >SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +1 Query: 1 LVDPPGCRNSARA 39 LVDPPGCRNS +A Sbjct: 15 LVDPPGCRNSIQA 27 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 29.1 bits (62), Expect = 3.6 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = -1 Query: 103 LIQGIKVRAWTTKII*NTMK**LVPNSCSPGDPL 2 L +G K+ ++ +T+ L+ NSCSPGDPL Sbjct: 12 LTKGNKMLVRGPPLLRSTVSISLISNSCSPGDPL 45 >SB_23213| Best HMM Match : SH3_1 (HMM E-Value=9.2e-12) Length = 979 Score = 28.7 bits (61), Expect = 4.7 Identities = 19/70 (27%), Positives = 30/70 (42%), Gaps = 1/70 (1%) Frame = +2 Query: 194 RSSLGGPRNHRAVYHWIRVP-MFNNPVSAFYKALLANAATSALRLHQRIPAREISLSRDF 370 +S G + RA W+ +F NPV+ ++ A AL + + A EI+L Sbjct: 885 KSGTQGDADRRATGLWVHKDGLFGNPVNTIFQDSSKKALYKALAEYNPVEAGEIALVEGD 944 Query: 371 MARFFLEDSA 400 F E +A Sbjct: 945 TVSFVREGNA 954 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = +1 Query: 1 LVDPPGCRNSARAI 42 LVDPPGCRNS I Sbjct: 15 LVDPPGCRNSIEVI 28 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.7 bits (61), Expect = 4.7 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -1 Query: 64 II*NTMK**LVPNSCSPGDPL 2 +I NT++ LV NSCSPGDPL Sbjct: 1 MIHNTLRI-LVSNSCSPGDPL 20 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 28.7 bits (61), Expect = 4.7 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +1 Query: 1 LVDPPGCRNSARAII 45 LVDPPGCRNS + + Sbjct: 70 LVDPPGCRNSMKVCV 84 >SB_30356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 531 Score = 28.7 bits (61), Expect = 4.7 Identities = 19/58 (32%), Positives = 25/58 (43%), Gaps = 1/58 (1%) Frame = +2 Query: 257 FNNPVSAFYKA-LLANAATSALRLHQRIPAREISLSRDFMARFFLEDSAHYLFYSLIF 427 F +P AFY LL A R+ R+P LSR A + DS + S+ F Sbjct: 299 FTDPTKAFYVTQLLKGYAKQGARVDTRLPITLAILSRILSAANIITDSPYEAMCSVAF 356 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 28.7 bits (61), Expect = 4.7 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = +1 Query: 1 LVDPPGCRNSARAII 45 LVDPPGCRNS + ++ Sbjct: 102 LVDPPGCRNSIQQMV 116 >SB_742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 28.7 bits (61), Expect = 4.7 Identities = 21/67 (31%), Positives = 28/67 (41%), Gaps = 8/67 (11%) Frame = +3 Query: 3 SGSPGLQEF--------GTSYYFIVFYIILVVQARTLIP*INMADQNQQAGDTGPPKGIP 158 SGSPGLQEF + F+ FY I ++ P I M G P G P Sbjct: 15 SGSPGLQEFDEYLLLTVSANLVFVCFYFIFRMEMEIQRPQIGMIKLIDTVDLEGGPVGKP 74 Query: 159 ALKAHII 179 + A ++ Sbjct: 75 VVPAALM 81 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 37 LVPNSCSPGDPL 2 LV NSCSPGDPL Sbjct: 24 LVSNSCSPGDPL 35 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 37 LVPNSCSPGDPL 2 LV NSCSPGDPL Sbjct: 3 LVSNSCSPGDPL 14 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 37 LVPNSCSPGDPL 2 LV NSCSPGDPL Sbjct: 17 LVSNSCSPGDPL 28 >SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +1 Query: 1 LVDPPGCRNSARA 39 LVDPPGCRNS A Sbjct: 15 LVDPPGCRNSIAA 27 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 37 LVPNSCSPGDPL 2 LV NSCSPGDPL Sbjct: 5 LVSNSCSPGDPL 16 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 37 LVPNSCSPGDPL 2 LV NSCSPGDPL Sbjct: 2 LVSNSCSPGDPL 13 >SB_36615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/21 (57%), Positives = 16/21 (76%), Gaps = 1/21 (4%) Frame = -3 Query: 62 YIKYYE-IIARAEFLQPGGST 3 Y+ Y E ++ + EFLQPGGST Sbjct: 6 YLTYAEAVLQKIEFLQPGGST 26 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 37 LVPNSCSPGDPL 2 LV NSCSPGDPL Sbjct: 26 LVSNSCSPGDPL 37 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 37 LVPNSCSPGDPL 2 LV NSCSPGDPL Sbjct: 26 LVSNSCSPGDPL 37 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 37 LVPNSCSPGDPL 2 L+ NSCSPGDPL Sbjct: 33 LISNSCSPGDPL 44 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 37 LVPNSCSPGDPL 2 L+ NSCSPGDPL Sbjct: 17 LISNSCSPGDPL 28 >SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) Length = 209 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +1 Query: 1 LVDPPGCRNSAR 36 LVDPPGCRNS + Sbjct: 15 LVDPPGCRNSIK 26 >SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +1 Query: 1 LVDPPGCRNSAR 36 LVDPPGCRNS + Sbjct: 15 LVDPPGCRNSMK 26 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 37 LVPNSCSPGDPL 2 L+ NSCSPGDPL Sbjct: 37 LISNSCSPGDPL 48 >SB_14602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.9 bits (59), Expect = 8.3 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 47 EIIARAEFLQPGGST 3 EI +R EFLQPGGST Sbjct: 12 EIKSRIEFLQPGGST 26 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +1 Query: 1 LVDPPGCRNSAR 36 LVDPPGCRNS + Sbjct: 15 LVDPPGCRNSIK 26 >SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) Length = 106 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +1 Query: 1 LVDPPGCRNSAR 36 LVDPPGCRNS + Sbjct: 15 LVDPPGCRNSMK 26 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 37 LVPNSCSPGDPL 2 L+ NSCSPGDPL Sbjct: 8 LISNSCSPGDPL 19 >SB_58013| Best HMM Match : ABC_membrane (HMM E-Value=6.3e-28) Length = 951 Score = 27.9 bits (59), Expect = 8.3 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -3 Query: 398 RCPPGRTSP*NPARGRSLVLEFFDVAAALKSQRSRVTLC 282 RCPPGR P P + + LV FD+ +K + S + +C Sbjct: 85 RCPPGRGGPILPVKTK-LVPSLFDIDLEVK-KGSLIGIC 121 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 37 LVPNSCSPGDPL 2 L+ NSCSPGDPL Sbjct: 33 LISNSCSPGDPL 44 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 37 LVPNSCSPGDPL 2 L+ NSCSPGDPL Sbjct: 33 LISNSCSPGDPL 44 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 37 LVPNSCSPGDPL 2 L+ NSCSPGDPL Sbjct: 33 LISNSCSPGDPL 44 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +1 Query: 1 LVDPPGCRNSAR 36 LVDPPGCRNS + Sbjct: 15 LVDPPGCRNSIK 26 >SB_46171| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.9 bits (59), Expect = 8.3 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -3 Query: 47 EIIARAEFLQPGGST 3 E++ R EFLQPGGST Sbjct: 3 EVMHRIEFLQPGGST 17 >SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +1 Query: 1 LVDPPGCRNSAR 36 LVDPPGCRNS + Sbjct: 15 LVDPPGCRNSIK 26 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 37 LVPNSCSPGDPL 2 L+ NSCSPGDPL Sbjct: 24 LISNSCSPGDPL 35 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 37 LVPNSCSPGDPL 2 L+ NSCSPGDPL Sbjct: 33 LISNSCSPGDPL 44 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 37 LVPNSCSPGDPL 2 L+ NSCSPGDPL Sbjct: 33 LISNSCSPGDPL 44 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 37 LVPNSCSPGDPL 2 L+ NSCSPGDPL Sbjct: 40 LISNSCSPGDPL 51 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 37 LVPNSCSPGDPL 2 L+ NSCSPGDPL Sbjct: 33 LISNSCSPGDPL 44 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 37 LVPNSCSPGDPL 2 L+ NSCSPGDPL Sbjct: 70 LISNSCSPGDPL 81 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 37 LVPNSCSPGDPL 2 L+ NSCSPGDPL Sbjct: 21 LISNSCSPGDPL 32 >SB_13869| Best HMM Match : Antirestrict (HMM E-Value=4.5) Length = 149 Score = 27.9 bits (59), Expect = 8.3 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -3 Query: 44 IIARAEFLQPGGST 3 I AR EFLQPGGST Sbjct: 22 IYARIEFLQPGGST 35 >SB_13618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.9 bits (59), Expect = 8.3 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -3 Query: 56 KYYEIIARAEFLQPGGST 3 ++Y +I EFLQPGGST Sbjct: 5 RHYYVIKFIEFLQPGGST 22 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 37 LVPNSCSPGDPL 2 L+ NSCSPGDPL Sbjct: 16 LISNSCSPGDPL 27 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 37 LVPNSCSPGDPL 2 L+ NSCSPGDPL Sbjct: 33 LISNSCSPGDPL 44 >SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +1 Query: 1 LVDPPGCRNSAR 36 LVDPPGCRNS + Sbjct: 15 LVDPPGCRNSMK 26 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -1 Query: 37 LVPNSCSPGDPL 2 L+ NSCSPGDPL Sbjct: 31 LISNSCSPGDPL 42 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,057,556 Number of Sequences: 59808 Number of extensions: 452296 Number of successful extensions: 2632 Number of sequences better than 10.0: 52 Number of HSP's better than 10.0 without gapping: 2567 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2632 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1805522550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -