BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30664.Seq (499 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g57860.1 68414.m06565 60S ribosomal protein L21 similar to 60... 113 8e-26 At1g57660.1 68414.m06543 60S ribosomal protein L21 (RPL21E) simi... 113 8e-26 At1g09690.1 68414.m01088 60S ribosomal protein L21 (RPL21C) Simi... 113 8e-26 At1g09590.1 68414.m01076 60S ribosomal protein L21 (RPL21A) Simi... 113 8e-26 At1g62330.1 68414.m07033 expressed protein contains Pfam PF03138... 30 1.00 At1g54926.1 68414.m06272 hypothetical protein 29 1.3 At5g05900.1 68418.m00651 UDP-glucoronosyl/UDP-glucosyl transfera... 29 1.7 At4g24350.1 68417.m03494 phosphorylase family protein contains P... 29 1.7 At3g45880.1 68416.m04965 hypothetical protein 29 2.3 At5g25320.1 68418.m03004 ACT domain-containing protein contains ... 28 3.0 At2g43900.1 68415.m05457 endonuclease/exonuclease/phosphatase fa... 28 3.0 At4g31490.1 68417.m04473 coatomer beta subunit, putative / beta-... 28 4.0 At1g20020.1 68414.m02507 ferredoxin--NADP(+) reductase, putative... 28 4.0 At5g41220.1 68418.m05009 glutathione S-transferase, putative sim... 27 5.3 At1g04680.1 68414.m00465 pectate lyase family protein similar to... 27 5.3 At5g41240.1 68418.m05011 glutathione S-transferase, putative sim... 27 7.0 At5g05890.1 68418.m00649 UDP-glucoronosyl/UDP-glucosyl transfera... 27 7.0 At1g76990.3 68414.m08966 ACT domain containing protein low simil... 27 7.0 At1g76990.2 68414.m08965 ACT domain containing protein low simil... 27 7.0 At1g76990.1 68414.m08964 ACT domain containing protein low simil... 27 7.0 At5g63320.1 68418.m07946 expressed protein 27 9.3 At5g56080.1 68418.m06997 nicotianamine synthase, putative simila... 27 9.3 At4g30860.1 68417.m04381 SET domain-containing protein low simil... 27 9.3 At3g52020.1 68416.m05706 serine carboxypeptidase S10 family prot... 27 9.3 At2g13150.1 68415.m01450 expressed protein contains a bZIP trans... 27 9.3 >At1g57860.1 68414.m06565 60S ribosomal protein L21 similar to 60S ribosomal protein L21 GI:3885884 from [Oryza sativa] Length = 164 Score = 113 bits (271), Expect = 8e-26 Identities = 50/86 (58%), Positives = 63/86 (73%) Frame = +3 Query: 15 MTNSKGYRXGTRDLFARRFRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGK 194 M G R TRDLFAR FR G IPLSTY++ +KVGD VD++ NGA+ KGMPHK YHG+ Sbjct: 1 MPAGHGVRARTRDLFARPFRKKGYIPLSTYLRTFKVGDYVDVKVNGAIHKGMPHKFYHGR 60 Query: 195 TGRVYNVTAHALGVIVNKRVAEGLYR 272 TGR++NVT A+GV VNK++ + R Sbjct: 61 TGRIWNVTKRAVGVEVNKQIGNRIIR 86 Score = 74.9 bits (176), Expect = 3e-14 Identities = 36/76 (47%), Positives = 51/76 (67%) Frame = +2 Query: 260 RIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVS 439 RII KRI++RVEHV+ S+C ++F R K+N+ L +AKA G+T++ KRQP PK +V Sbjct: 83 RIIRKRIHVRVEHVQQSRCAEEFKLRKKQNDVLKADAKARGETISTKRQPKGPKPGFMVE 142 Query: 440 GTEKPVLLAPIPYEFV 487 G + PIPY+ V Sbjct: 143 GMTLET-VTPIPYDVV 157 >At1g57660.1 68414.m06543 60S ribosomal protein L21 (RPL21E) similar to 60S ribosomal protein L21 GB:Q43291 GI:2851508 from [Arabidopsis thaliana] Length = 164 Score = 113 bits (271), Expect = 8e-26 Identities = 50/86 (58%), Positives = 63/86 (73%) Frame = +3 Query: 15 MTNSKGYRXGTRDLFARRFRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGK 194 M G R TRDLFAR FR G IPLSTY++ +KVGD VD++ NGA+ KGMPHK YHG+ Sbjct: 1 MPAGHGVRARTRDLFARPFRKKGYIPLSTYLRTFKVGDYVDVKVNGAIHKGMPHKFYHGR 60 Query: 195 TGRVYNVTAHALGVIVNKRVAEGLYR 272 TGR++NVT A+GV VNK++ + R Sbjct: 61 TGRIWNVTKRAVGVEVNKQIGNRIIR 86 Score = 74.9 bits (176), Expect = 3e-14 Identities = 36/76 (47%), Positives = 51/76 (67%) Frame = +2 Query: 260 RIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVS 439 RII KRI++RVEHV+ S+C ++F R K+N+ L +AKA G+T++ KRQP PK +V Sbjct: 83 RIIRKRIHVRVEHVQQSRCAEEFKLRKKQNDVLKADAKARGETISTKRQPKGPKPGFMVE 142 Query: 440 GTEKPVLLAPIPYEFV 487 G + PIPY+ V Sbjct: 143 GMTLET-VTPIPYDVV 157 >At1g09690.1 68414.m01088 60S ribosomal protein L21 (RPL21C) Similar to ribosomal protein L21 (gb|L38826). ESTs gb|AA395597,gb|ATTS5197 come from this gene Length = 164 Score = 113 bits (271), Expect = 8e-26 Identities = 50/86 (58%), Positives = 63/86 (73%) Frame = +3 Query: 15 MTNSKGYRXGTRDLFARRFRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGK 194 M G R TRDLFAR FR G IPLSTY++ +KVGD VD++ NGA+ KGMPHK YHG+ Sbjct: 1 MPAGHGVRARTRDLFARPFRKKGYIPLSTYLRTFKVGDYVDVKVNGAIHKGMPHKFYHGR 60 Query: 195 TGRVYNVTAHALGVIVNKRVAEGLYR 272 TGR++NVT A+GV VNK++ + R Sbjct: 61 TGRIWNVTKRAVGVEVNKQIGNRIIR 86 Score = 74.1 bits (174), Expect = 5e-14 Identities = 36/76 (47%), Positives = 50/76 (65%) Frame = +2 Query: 260 RIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVS 439 RII KRI++RVEHV+ S+C ++F R K+N+ L AKA G+T++ KRQP PK +V Sbjct: 83 RIIRKRIHVRVEHVQQSRCAEEFKLRKKKNDELKAAAKANGETISTKRQPKGPKPGFMVE 142 Query: 440 GTEKPVLLAPIPYEFV 487 G + PIPY+ V Sbjct: 143 GMTLET-VTPIPYDVV 157 >At1g09590.1 68414.m01076 60S ribosomal protein L21 (RPL21A) Similar to L21 family of ribosomal protein; amino acid sequence is identical to F21M12.8 Length = 164 Score = 113 bits (271), Expect = 8e-26 Identities = 50/86 (58%), Positives = 63/86 (73%) Frame = +3 Query: 15 MTNSKGYRXGTRDLFARRFRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGK 194 M G R TRDLFAR FR G IPLSTY++ +KVGD VD++ NGA+ KGMPHK YHG+ Sbjct: 1 MPAGHGVRARTRDLFARPFRKKGYIPLSTYLRTFKVGDYVDVKVNGAIHKGMPHKFYHGR 60 Query: 195 TGRVYNVTAHALGVIVNKRVAEGLYR 272 TGR++NVT A+GV VNK++ + R Sbjct: 61 TGRIWNVTKRAVGVEVNKQIGNRIIR 86 Score = 74.1 bits (174), Expect = 5e-14 Identities = 36/76 (47%), Positives = 50/76 (65%) Frame = +2 Query: 260 RIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVS 439 RII KRI++RVEHV+ S+C ++F R K+N+ L AKA G+T++ KRQP PK +V Sbjct: 83 RIIRKRIHVRVEHVQQSRCAEEFKLRKKKNDELKAAAKANGETISTKRQPKGPKPGFMVE 142 Query: 440 GTEKPVLLAPIPYEFV 487 G + PIPY+ V Sbjct: 143 GMTLET-VTPIPYDVV 157 >At1g62330.1 68414.m07033 expressed protein contains Pfam PF03138: Plant protein family. The function of this family of plant proteins is unknown; Length = 672 Score = 29.9 bits (64), Expect = 1.00 Identities = 21/65 (32%), Positives = 27/65 (41%) Frame = +3 Query: 165 GMPHKVYHGKTGRVYNVTAHALGVIVNKRVAEGLYRXXXXXXXXXXXXXXADKTSLRESK 344 G P K Y+G GR+ AHAL NK + L+R AD+ S + S Sbjct: 182 GKPKKTYNGTYGRLLAYAAHALAEGQNKLEPKELWR--EPKDQALAWKPCADQRSWKPSD 239 Query: 345 RMRGY 359 GY Sbjct: 240 GKNGY 244 >At1g54926.1 68414.m06272 hypothetical protein Length = 273 Score = 29.5 bits (63), Expect = 1.3 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 233 CDCQQACCGRIIPKRINIRVEHVKHSK 313 CD + C R+ PK +I +H KH K Sbjct: 59 CDLSEGCKNRMTPKAFHIISQHPKHHK 85 >At5g05900.1 68418.m00651 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 450 Score = 29.1 bits (62), Expect = 1.7 Identities = 19/54 (35%), Positives = 23/54 (42%) Frame = -3 Query: 248 LVDNHTESMSSHVVHATCLSMVYFVWHTLLNCTIASDVYNVSNFVHFHVRGERN 87 L N S V + + FVW LLN SDV+ V +H R ERN Sbjct: 346 LTHNGWNSTVESVFEGVPMICMPFVWDQLLNARFVSDVWMVG--LHLEGRIERN 397 >At4g24350.1 68417.m03494 phosphorylase family protein contains Pfam PF01048: Phosphorylase family Length = 336 Score = 29.1 bits (62), Expect = 1.7 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -3 Query: 140 DVYNVSNFVHFHVRGERNSSM 78 DV+NV VHF + G N+SM Sbjct: 114 DVFNVKGIVHFGIAGNMNNSM 134 >At3g45880.1 68416.m04965 hypothetical protein Length = 431 Score = 28.7 bits (61), Expect = 2.3 Identities = 19/55 (34%), Positives = 24/55 (43%) Frame = -1 Query: 409 WLSLQVDGLAGSLGFLQ*PLILFDSLKEVLSALGVLDMLXTDIDALRYNPSATRL 245 W +Q D FLQ L SL VLS D +D + ++ PSAT L Sbjct: 299 WYDMQFDIKYAYFNFLQSLLYKSSSLNPVLSWREDEDSESSDAEGSKFTPSATNL 353 >At5g25320.1 68418.m03004 ACT domain-containing protein contains Pfam ACT domain PF01842 Length = 500 Score = 28.3 bits (60), Expect = 3.0 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +2 Query: 152 CSSKGYATQSIPWKDRSRVQRDCSCSRCDCQ 244 C +GY+ ++ KDR R+ D C+ D Q Sbjct: 291 CEERGYSIVTVKSKDRRRLMFDTICTLVDMQ 321 >At2g43900.1 68415.m05457 endonuclease/exonuclease/phosphatase family protein belongs to Pfam:PF03372: Endonuclease/Exonuclease/phosphatase family; contains 3 WD-40 repeats (PF00400);similar to Type II inositol-1,4,5-trisphosphate 5-phosphatase EC 3.1.3.56 (5PTASE) (INPP5B) (SP:P32019) [Homo sapiens] Length = 1305 Score = 28.3 bits (60), Expect = 3.0 Identities = 10/28 (35%), Positives = 20/28 (71%) Frame = +2 Query: 275 RINIRVEHVKHSKCRQDFLKRVKENERL 358 + ++++EHV S RQ+F + +K NE++ Sbjct: 920 KFHVKIEHVDRSVRRQEFGRIIKTNEKV 947 >At4g31490.1 68417.m04473 coatomer beta subunit, putative / beta-coat protein, putative / beta-COP, putative similar to Coatomer beta subunit (Beta-coat protein) (Beta-COP) from {Rattus norvegicus} SP|P23514, {Mus musculus} SP|Q9JIF7, {Homo sapiens} SP|P53618; contains Pfam profile: PF01602 Adaptin N terminal region Length = 948 Score = 27.9 bits (59), Expect = 4.0 Identities = 14/48 (29%), Positives = 28/48 (58%), Gaps = 1/48 (2%) Frame = +2 Query: 254 CGRIIPKRINIRVEHVKHSKCRQDFLKRVKENE-RLLKEAKAAGKTVN 394 C +++ R N+ ++ + CRQ F+K + E + R ++E KA +T + Sbjct: 620 CIKLLCHR-NVEMKKIWLESCRQSFVKMISEKQLREMEELKAKTQTTH 666 >At1g20020.1 68414.m02507 ferredoxin--NADP(+) reductase, putative / adrenodoxin reductase, putative strong similarity to Ferredoxin--NADP reductase, chloroplast precursor (EC 1.18.1.2) (FNR) from {Pisum sativum} SP|P10933, {Mesembryanthemum crystallinum} SP|P41343, {Spinacia oleracea} SP|P00455, [Capsicum annuum] GI:6899972 Length = 369 Score = 27.9 bits (59), Expect = 4.0 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = +3 Query: 114 YKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVN 245 Y+ G V + +G + G PHKV R+Y++ + ALG + N Sbjct: 125 YREGQSVGVIADGIDKNGKPHKV------RLYSIASSALGDLGN 162 >At5g41220.1 68418.m05009 glutathione S-transferase, putative similar to emb|CAA10662 Length = 590 Score = 27.5 bits (58), Expect = 5.3 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 74 HTWNYSALHVHESVQSWRHCRHQRQWCS 157 +T NY + E +WR RH ++WCS Sbjct: 370 YTNNYKSNFTLE--HAWRELRHSKKWCS 395 >At1g04680.1 68414.m00465 pectate lyase family protein similar to pectate lyase GP:14531296 from [Fragaria x ananassa] Length = 431 Score = 27.5 bits (58), Expect = 5.3 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Frame = -3 Query: 191 SMVYFVWHTLLNCTIASDVYNVSNFVHFHVRGERNS-SMCAEPASEQVPGAAAVTLGVRH 15 S +F W T+ +D +S F HV + NS S CA+ + V G+ A+T+ H Sbjct: 216 SETHFGWRTM------ADGDAISIFGSSHVWIDHNSLSHCADGLVDAVMGSTAITISNNH 269 Query: 14 L 12 L Sbjct: 270 L 270 >At5g41240.1 68418.m05011 glutathione S-transferase, putative similar to glutathione S-transferase, GST 10b GB:CAA10662 [Arabidopsis thaliana] 37349. Length = 591 Score = 27.1 bits (57), Expect = 7.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +2 Query: 119 SWRHCRHQRQWCSS 160 +WR RH ++WCS+ Sbjct: 385 AWRELRHNKKWCST 398 >At5g05890.1 68418.m00649 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 455 Score = 27.1 bits (57), Expect = 7.0 Identities = 22/80 (27%), Positives = 31/80 (38%) Frame = -3 Query: 248 LVDNHTESMSSHVVHATCLSMVYFVWHTLLNCTIASDVYNVSNFVHFHVRGERNSSMCAE 69 L N S V A + + F W +LN SDV+ V ++ R ERN A Sbjct: 351 LTHNGWSSTVESVCEAVPMICLPFRWDQMLNARFVSDVWMVG--INLEDRVERNEIEGAI 408 Query: 68 PASEQVPGAAAVTLGVRHLR 9 P A+ + HL+ Sbjct: 409 RRLLVEPEGEAIRERIEHLK 428 >At1g76990.3 68414.m08966 ACT domain containing protein low similarity to uridylyltransferase SP|P56884 from Rhizobium meliloti; contains Pfam ACT domain PF01842 Length = 453 Score = 27.1 bits (57), Expect = 7.0 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +2 Query: 152 CSSKGYATQSIPWKDRSRVQRDCSCSRCDCQ 244 C KGY+ ++ +DR ++ D C+ D Q Sbjct: 259 CEEKGYSVINVSCEDRPKLMFDIVCTLTDMQ 289 >At1g76990.2 68414.m08965 ACT domain containing protein low similarity to uridylyltransferase SP|P56884 from Rhizobium meliloti; contains Pfam ACT domain PF01842 Length = 453 Score = 27.1 bits (57), Expect = 7.0 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +2 Query: 152 CSSKGYATQSIPWKDRSRVQRDCSCSRCDCQ 244 C KGY+ ++ +DR ++ D C+ D Q Sbjct: 259 CEEKGYSVINVSCEDRPKLMFDIVCTLTDMQ 289 >At1g76990.1 68414.m08964 ACT domain containing protein low similarity to uridylyltransferase SP|P56884 from Rhizobium meliloti; contains Pfam ACT domain PF01842 Length = 453 Score = 27.1 bits (57), Expect = 7.0 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +2 Query: 152 CSSKGYATQSIPWKDRSRVQRDCSCSRCDCQ 244 C KGY+ ++ +DR ++ D C+ D Q Sbjct: 259 CEEKGYSVINVSCEDRPKLMFDIVCTLTDMQ 289 >At5g63320.1 68418.m07946 expressed protein Length = 569 Score = 26.6 bits (56), Expect = 9.3 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +2 Query: 317 RQDFLKRVKEN-ERLLKEAKAAGKTVNLKRQPAPPKA 424 R++F KR++E ERL EAKAA + + A KA Sbjct: 103 REEFEKRLREEKERLQAEAKAAEEARRKAKAEAAEKA 139 >At5g56080.1 68418.m06997 nicotianamine synthase, putative similar to nicotianamine synthase [Lycopersicon esculentum][GI:4753801], nicotianamine synthase 2 [Hordeum vulgare][GI:4894912] Length = 320 Score = 26.6 bits (56), Expect = 9.3 Identities = 24/90 (26%), Positives = 42/90 (46%), Gaps = 4/90 (4%) Frame = -3 Query: 263 SFRNTLVDNHTESMSSHVVHATCLSMVYFVWHT--LLNCTIASDVYNVSNFVHFHVRGER 90 +F N +D+H +++S++V ++HT +LN D Y+V F+ V ++ Sbjct: 151 TFHNFDIDSHANTLASNLVSRDSDLSKRMIFHTTDVLNAKEGLDQYDVV-FLAALVGMDK 209 Query: 89 NSSMCAEPASEQ--VPGAAAVTLGVRHLRA 6 S + A E+ PGA + LRA Sbjct: 210 ESKVKAIEHLEKHMAPGAVVMLRSAHGLRA 239 >At4g30860.1 68417.m04381 SET domain-containing protein low similarity to IL-5 promoter REII-region-binding protein [Homo sapiens] GI:12642795; contains Pfam profile PF00856: SET domain Length = 497 Score = 26.6 bits (56), Expect = 9.3 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 3/41 (7%) Frame = +2 Query: 194 DRSRVQR-DC-SCSR-CDCQQACCGRIIPKRINIRVEHVKH 307 DRS V R C SCS+ C C ++C R K I++ +H Sbjct: 295 DRSCVCRVQCISCSKGCSCPESCGNRPFRKEKKIKIVKTEH 335 >At3g52020.1 68416.m05706 serine carboxypeptidase S10 family protein similar to SP|P52711 Serine carboxypeptidase II-3 precursor (EC 3.4.16.6) Hordeum vulgare; contains Pfam profile PF0450 serine carboxypeptidase Length = 501 Score = 26.6 bits (56), Expect = 9.3 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 Query: 477 YGIGASKTGFSVPLTMWAALGGAGC 403 Y + A+KT S+PL +W GG GC Sbjct: 111 YFVEATKTKKSLPLVLWLN-GGPGC 134 >At2g13150.1 68415.m01450 expressed protein contains a bZIP transcription factor basic domain signature (PDOC00036) Length = 262 Score = 26.6 bits (56), Expect = 9.3 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +3 Query: 369 PRLPARPST*RDSQLPLKLPTSSVELRNPS 458 P L PS+ R + +PL P++SVE R+ S Sbjct: 26 PPLSPSPSSSRRNSIPLMNPSASVESRDSS 55 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,600,744 Number of Sequences: 28952 Number of extensions: 212661 Number of successful extensions: 703 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 685 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 703 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 878448512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -