BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30663.Seq (748 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g80460.1 68414.m09423 glycerol kinase, putative similar to gl... 48 5e-06 At4g30310.3 68417.m04309 ribitol kinase, putative similar to rib... 35 0.066 At4g30310.2 68417.m04308 ribitol kinase, putative similar to rib... 35 0.066 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 32 0.35 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 32 0.35 At4g24900.1 68417.m03564 expressed protein 30 1.9 At3g27060.1 68416.m03385 ribonucleoside-diphosphate reductase sm... 30 1.9 At1g70620.2 68414.m08137 cyclin-related contains weak similarity... 30 1.9 At5g52040.2 68418.m06459 arginine/serine-rich splicing factor RS... 29 4.3 At5g52040.1 68418.m06458 arginine/serine-rich splicing factor RS... 29 4.3 At2g40070.1 68415.m04923 expressed protein 29 4.3 At1g74260.1 68414.m08600 AIR synthase-related family protein con... 29 4.3 At1g27750.1 68414.m03391 ubiquitin system component Cue domain-c... 29 4.3 At5g27420.1 68418.m03273 zinc finger (C3HC4-type RING finger) fa... 28 5.7 At3g02830.1 68416.m00275 zinc finger (CCCH-type) family protein ... 28 5.7 At1g10520.1 68414.m01184 DNA polymerase lambda (POLL) identical ... 28 5.7 At5g24480.1 68418.m02885 hypothetical protein similar to unknown... 28 7.6 At3g14130.1 68416.m01787 (S)-2-hydroxy-acid oxidase, peroxisomal... 28 7.6 At4g39030.1 68417.m05528 enhanced disease susceptibility 5 (EDS5... 27 10.0 At2g29210.1 68415.m03550 splicing factor PWI domain-containing p... 27 10.0 >At1g80460.1 68414.m09423 glycerol kinase, putative similar to glycerol kinase (ATP:glycerol 3-phosphotransferase, Glycerokinase, GK)[Mycobacterium tuberculosis] Swiss-Prot:O69664 Length = 522 Score = 48.4 bits (110), Expect = 5e-06 Identities = 21/36 (58%), Positives = 29/36 (80%) Frame = -3 Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVW 402 +Q+QADL+G PV+RP+ +E+TALGAA AG A+ W Sbjct: 438 MQIQADLMGSPVVRPVDIETTALGAAYAAGLAVGFW 473 Score = 35.9 bits (79), Expect = 0.029 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = -2 Query: 702 PYWRKDARGVMCGLSERTRRQHIVR 628 P+WR+DARGV G++ T + HI R Sbjct: 365 PWWREDARGVCIGITRFTNKSHIAR 389 Score = 28.3 bits (60), Expect = 5.7 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = -1 Query: 739 ISFVPAFNGLYSPILEKRRQGSDVRFERKDSTSAYCQGPRWEAVCHQTR 593 + FVPAFNGL++P + +G + R + S + E++C Q + Sbjct: 353 VYFVPAFNGLFAPWWREDARGVCIGITRFTNKSHIARAV-LESMCFQVK 400 >At4g30310.3 68417.m04309 ribitol kinase, putative similar to ribitol kinase [Klebsiella pneumoniae] gi|2905643|gb|AAC26495 Length = 451 Score = 34.7 bits (76), Expect = 0.066 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = -3 Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVWPT 396 +Q AD++G P+I P ES LGAAI+ A + +P+ Sbjct: 361 IQEHADIVGCPIILPRESESVLLGAAILGAVAGKNYPS 398 >At4g30310.2 68417.m04308 ribitol kinase, putative similar to ribitol kinase [Klebsiella pneumoniae] gi|2905643|gb|AAC26495 Length = 579 Score = 34.7 bits (76), Expect = 0.066 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = -3 Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVWPT 396 +Q AD++G P+I P ES LGAAI+ A + +P+ Sbjct: 489 IQEHADIVGCPIILPRESESVLLGAAILGAVAGKNYPS 526 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 32.3 bits (70), Expect = 0.35 Identities = 17/39 (43%), Positives = 24/39 (61%), Gaps = 3/39 (7%) Frame = +1 Query: 514 LSSAPSLRRRGVAS---GARSLQPSRPPRRASGDTRPPS 621 LSS + RR +A+ + S PSRPP+R+ G RPP+ Sbjct: 127 LSSMLDIPRRNLATKPGSSPSPSPSRPPKRSRGPPRPPT 165 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 32.3 bits (70), Expect = 0.35 Identities = 17/39 (43%), Positives = 24/39 (61%), Gaps = 3/39 (7%) Frame = +1 Query: 514 LSSAPSLRRRGVAS---GARSLQPSRPPRRASGDTRPPS 621 LSS + RR +A+ + S PSRPP+R+ G RPP+ Sbjct: 127 LSSMLDIPRRNLATKPGSSPSPSPSRPPKRSRGPPRPPT 165 >At4g24900.1 68417.m03564 expressed protein Length = 421 Score = 29.9 bits (64), Expect = 1.9 Identities = 19/52 (36%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = -2 Query: 510 CADAG*FTGYTSHSSPHDGK-YSPGGGHCRRSRNACVAHDNTQPTGRYIPAG 358 C ++G G+ HS P K YS G +C + N V+ D Q G Y P G Sbjct: 224 CDESG--NGFGEHSIPCRSKDYSGNGNYCTQE-NYQVSQDKKQIDGSYNPPG 272 >At3g27060.1 68416.m03385 ribonucleoside-diphosphate reductase small chain, putative / ribonucleotide reductase, putative similar to ribonucleotide reductase R2 [Nicotiana tabacum] GI:1044912; contains Pfam profile PF00268: Ribonucleotide reductase, small chain Length = 332 Score = 29.9 bits (64), Expect = 1.9 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = -2 Query: 663 LSERTRRQHIVRGRAGRPCVTRRAPWRTRWL 571 + + R H+ R PCV ++A W +W+ Sbjct: 122 IKDNKERDHLFRAIETIPCVAKKAQWAMKWI 152 >At1g70620.2 68414.m08137 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 884 Score = 29.9 bits (64), Expect = 1.9 Identities = 23/74 (31%), Positives = 30/74 (40%), Gaps = 1/74 (1%) Frame = +2 Query: 398 WATHALRDLRQWPPPGLYFPS*GDE*LVYPVNQPASAQN*VLRHPSV-GEELPQGRAVCS 574 + TH +D Q PG+ + + V P QP N + S G LPQ S Sbjct: 181 YPTHGYQDFHQQAVPGVSYQQ-HQQFPVPPTTQPERYPNYATGNESFPGVGLPQENLPTS 239 Query: 575 HRVRHGARLVTHGL 616 + RLVTH L Sbjct: 240 SAIHQQERLVTHKL 253 >At5g52040.2 68418.m06459 arginine/serine-rich splicing factor RSP41 (RSP41) nearly identical to SP|P92966 Arginine/serine-rich splicing factor RSP41 {Arabidopsis thaliana} Length = 357 Score = 28.7 bits (61), Expect = 4.3 Identities = 23/82 (28%), Positives = 31/82 (37%) Frame = +1 Query: 409 RIARPATMAAPRAVLSIMRGRMTGIPSKSACICTELSSAPSLRRRGVASGARSLQPSRPP 588 R A P R RGR + P K A + + RR VAS +R P Sbjct: 207 RGASPVAHKRERTSPDYGRGRRSPSPYKRARLSPDYKR-DDRRRERVASPENGAVRNRSP 265 Query: 589 RRASGDTRPPSAAPDNMLTSSP 654 R+ G++R P + SP Sbjct: 266 RKGRGESRSPPPYEKRRESRSP 287 >At5g52040.1 68418.m06458 arginine/serine-rich splicing factor RSP41 (RSP41) nearly identical to SP|P92966 Arginine/serine-rich splicing factor RSP41 {Arabidopsis thaliana} Length = 356 Score = 28.7 bits (61), Expect = 4.3 Identities = 23/82 (28%), Positives = 31/82 (37%) Frame = +1 Query: 409 RIARPATMAAPRAVLSIMRGRMTGIPSKSACICTELSSAPSLRRRGVASGARSLQPSRPP 588 R A P R RGR + P K A + + RR VAS +R P Sbjct: 207 RGASPVAHKRERTSPDYGRGRRSPSPYKRARLSPDYKR-DDRRRERVASPENGAVRNRSP 265 Query: 589 RRASGDTRPPSAAPDNMLTSSP 654 R+ G++R P + SP Sbjct: 266 RKGRGESRSPPPYEKRRESRSP 287 >At2g40070.1 68415.m04923 expressed protein Length = 607 Score = 28.7 bits (61), Expect = 4.3 Identities = 22/85 (25%), Positives = 36/85 (42%) Frame = +1 Query: 415 ARPATMAAPRAVLSIMRGRMTGIPSKSACICTELSSAPSLRRRGVASGARSLQPSRPPRR 594 +RPAT+ + A S + S+ LSS+ RR +SG +P+ P R Sbjct: 133 SRPATLTSRLANSSTESAARNHLTSRQQTSSPGLSSSSGASRRPSSSGGPGSRPATPTGR 192 Query: 595 ASGDTRPPSAAPDNMLTSSPFAQTA 669 +S T ++ + TS +A Sbjct: 193 SSTLTANSKSSRPSTPTSRATVSSA 217 >At1g74260.1 68414.m08600 AIR synthase-related family protein contains Pfam profiles: PF00586 AIR synthase related protein, N-terminal domain, PF02769 AIR synthase related protein, C-terminal domain Length = 1387 Score = 28.7 bits (61), Expect = 4.3 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -3 Query: 608 VSPDARRGGRDGCRLRAPEATPRRRRDGAELSSV 507 V+PD + GG DG L A +RR G+ L+ V Sbjct: 898 VTPDLKLGGDDGILLHVDLAKGKRRLGGSALAQV 931 >At1g27750.1 68414.m03391 ubiquitin system component Cue domain-containing protein very low similarity to ASC-1 complex subunit P100 [Homo sapiens] GI:12061187; contains Pfam profile PF02845: CUE domain Length = 1973 Score = 28.7 bits (61), Expect = 4.3 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 5/69 (7%) Frame = -1 Query: 388 PAHRPIHSCRLLPMKNEKCGEFVGKKP*INAWDGPILK--MNMST---QKIR*NYCSFAA 224 P P+ S RL PM + CG K+ + W G + K ++ ST Q++ + C + Sbjct: 899 PPFSPLLSPRLPPMVTQLCGSEASKQNIGHQWQGALSKSGVHYSTIIAQRLESDICKYII 958 Query: 223 GTFFPRNRP 197 G+ P P Sbjct: 959 GSPEPVQWP 967 >At5g27420.1 68418.m03273 zinc finger (C3HC4-type RING finger) family protein similar to RING-H2 zinc finger protein ATL6 [Arabidopsis thaliana] gi|4928403|gb|AAD33584.1|AF132016_1[4928403]; contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 368 Score = 28.3 bits (60), Expect = 5.7 Identities = 19/50 (38%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = -2 Query: 498 G*FTGYTSH-SSPHDGKYSPGGGHCRRSRNACVAHDNTQPTGRYIPAGSY 352 G FT Y H + DG +P GG RR NA VA T P Y Sbjct: 60 GFFTVYIRHCTGAVDGSVTPAGGARRRVTNATVARGLDAETIETFPTFVY 109 >At3g02830.1 68416.m00275 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 397 Score = 28.3 bits (60), Expect = 5.7 Identities = 14/46 (30%), Positives = 17/46 (36%) Frame = -2 Query: 486 GYTSHSSPHDGKYSPGGGHCRRSRNACVAHDNTQPTGRYIPAGSYQ 349 GY S+ D Y GHC+ H QPT +P Q Sbjct: 127 GYPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTNMMVPTSGQQ 172 >At1g10520.1 68414.m01184 DNA polymerase lambda (POLL) identical to DNA polymerase lambda GI:12053869 from [Arabidopsis thaliana] Length = 529 Score = 28.3 bits (60), Expect = 5.7 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -2 Query: 552 GNSSPTEGWRRTQFCADAG*FTGYTSHSSPHDGKYSP 442 G+ + +RT++ DAG F G SHS+ SP Sbjct: 128 GSEDQSSPQKRTRYSPDAGDFKGVESHSNTQGSPDSP 164 >At5g24480.1 68418.m02885 hypothetical protein similar to unknown protein (gb|AAD32930.1) Length = 350 Score = 27.9 bits (59), Expect = 7.6 Identities = 14/39 (35%), Positives = 18/39 (46%), Gaps = 3/39 (7%) Frame = -3 Query: 470 RPLMMESTALGAAIVAGRAMRVWPTTIPSP---PADTFL 363 RP ++ + R R WP T+PSP A TFL Sbjct: 10 RPHFQSIHFFDCSLTSDRGQRSWPATLPSPQPLSASTFL 48 >At3g14130.1 68416.m01787 (S)-2-hydroxy-acid oxidase, peroxisomal, putative / glycolate oxidase, putative / short chain alpha-hydroxy acid oxidase, putative similar to Chain A, Glycolate Oxidase (E.C.1.1.3.15) Mutant With Tyr 24 Replaced By Phe (Y24f) gi|999542 Length = 363 Score = 27.9 bits (59), Expect = 7.6 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = -3 Query: 539 RRRDGAELSSVQMQADLLGIPVIRPLMMESTAL 441 R R ++S++ M +LG P+ P+M+ TA+ Sbjct: 49 RPRVLVDVSNIDMSTSMLGYPISAPIMIAPTAM 81 >At4g39030.1 68417.m05528 enhanced disease susceptibility 5 (EDS5) / salicylic acid induction deficient 1 (SID1) identical to SP|Q945F0; contains Pfam profile PF01554: Uncharacterized membrane protein family Length = 543 Score = 27.5 bits (58), Expect = 10.0 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = -1 Query: 442 WGRPLSQVAQCVCGPRQYPAHRPIHSCRLL 353 WG PLSQ AQ Y A+R + R L Sbjct: 371 WGEPLSQTAQSFMPEMLYGANRNLPKARTL 400 >At2g29210.1 68415.m03550 splicing factor PWI domain-containing protein contains Pfam profile PF01480: PWI domain Length = 878 Score = 27.5 bits (58), Expect = 10.0 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +1 Query: 517 SSAPSLRRRGVASGARSLQPSRPPRRASGDTRPPS 621 S APS RRR + AR + PP R PP+ Sbjct: 303 SPAPSRRRRSPSPPARRRRSPSPPARRRRSPSPPA 337 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,290,750 Number of Sequences: 28952 Number of extensions: 368307 Number of successful extensions: 1048 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 968 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1046 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1653386488 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -