BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30661.Seq (698 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g13530.1 68416.m01701 MAP3K epsilon protein kinase identical ... 31 0.97 At1g10760.1 68414.m01231 starch excess protein (SEX1) identical ... 29 3.0 At3g07980.1 68416.m00975 protein kinase, putative similar to MAP... 28 6.8 At2g31510.1 68415.m03850 IBR domain-containing protein / ARIADNE... 27 9.0 At1g65580.1 68414.m07439 endonuclease/exonuclease/phosphatase fa... 27 9.0 >At3g13530.1 68416.m01701 MAP3K epsilon protein kinase identical to MAP3K epsilon protein kinase [Arabidopsis thaliana] gi|3549652|emb|CAA12272 Length = 1368 Score = 30.7 bits (66), Expect = 0.97 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +2 Query: 320 DSLGVGSYG*TNTNSWKGNPSYVPLGSISLEGIVSEELN 436 D +G G+YG N +V + +SLE IV E+LN Sbjct: 24 DEIGKGAYGRVYKGLDLENGDFVAIKQVSLENIVQEDLN 62 >At1g10760.1 68414.m01231 starch excess protein (SEX1) identical to SEX1 [Arabidopsis thaliana] GI:12044358; supporting cDNA gi|12044357|gb|AF312027.1|AF312027 Length = 1399 Score = 29.1 bits (62), Expect = 3.0 Identities = 18/49 (36%), Positives = 26/49 (53%) Frame = +2 Query: 299 TTDLNGSDSLGVGSYG*TNTNSWKGNPSYVPLGSISLEGIVSEELNMSV 445 T+DL G+ S +G Y SW G P+ V L E ++SE+ N +V Sbjct: 1089 TSDLVGAKSRNIG-YLKGKVPSWVGIPTSVALPFGVFEKVISEKANQAV 1136 >At3g07980.1 68416.m00975 protein kinase, putative similar to MAP3K epsilon protein kinase [Arabidopsis thaliana] gi|3549652|emb|CAA12272 Length = 1367 Score = 27.9 bits (59), Expect = 6.8 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +2 Query: 320 DSLGVGSYG*TNTNSWKGNPSYVPLGSISLEGIVSEELN 436 D +G G+YG N +V + +SLE I E+LN Sbjct: 24 DEIGKGAYGRVYIGLDLENGDFVAIKQVSLENIGQEDLN 62 >At2g31510.1 68415.m03850 IBR domain-containing protein / ARIADNE-like protein ARI7 (ARI7) identical to ARIADNE-like protein ARI7 [Arabidopsis thaliana] GI:29125028; contains similarity to Swiss-Prot:Q94981 ariadne-1 protein (Ari-1) [Drosophila melanogaster]; contains Pfam profile PF01485: IBR domain Length = 562 Score = 27.5 bits (58), Expect = 9.0 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 385 CTLRQHQPRRHSVRGVEHVSXNLSLVQ 465 C LR+ RRH + +E VS LS+ + Sbjct: 61 CVLREEDIRRHQMDNIERVSVVLSITE 87 >At1g65580.1 68414.m07439 endonuclease/exonuclease/phosphatase family protein similar to inositol polyphosphate 5-phosphatase II isoform (GI:15418718) [Mus musculus]; contains 6 (5 weak) Pfam: Pf00400 WD domain, G-beta repeats and Pfam PF03372: Endonuclease/Exonuclease/phosphatase family Length = 1101 Score = 27.5 bits (58), Expect = 9.0 Identities = 22/69 (31%), Positives = 34/69 (49%), Gaps = 1/69 (1%) Frame = +2 Query: 335 GSYG*TNTNSWKGNPSYVPLGSISLEG-IVSEELNMSVGIFPWSKSL*ISAIGKESSLKM 511 G +G SW+ + V +IS G I S ++ ++PW A+GK SLKM Sbjct: 213 GDHGIEEALSWQAHRGPVLSIAISAYGDIWSGSEGGALKVWPWD-----GALGKSLSLKM 267 Query: 512 QSQ*MNALS 538 + + M AL+ Sbjct: 268 EERHMAALA 276 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,052,971 Number of Sequences: 28952 Number of extensions: 236516 Number of successful extensions: 605 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 579 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 605 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -