BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30645.Seq (551 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z70684-7|CAA94601.1| 143|Caenorhabditis elegans Hypothetical pr... 132 2e-31 Z92838-1|CAB07406.1| 157|Caenorhabditis elegans Hypothetical pr... 36 0.026 Z81128-8|CAB03402.1| 811|Caenorhabditis elegans Hypothetical pr... 29 2.9 Z70204-5|CAI46566.1| 379|Caenorhabditis elegans Hypothetical pr... 28 5.1 Z70204-4|CAA94114.2| 437|Caenorhabditis elegans Hypothetical pr... 28 5.1 AY305832-1|AAR11977.1| 437|Caenorhabditis elegans nuclear recep... 28 5.1 AY305831-1|AAR11976.1| 437|Caenorhabditis elegans nuclear recep... 28 5.1 AF273775-1|AAG15124.1| 383|Caenorhabditis elegans nuclear recep... 28 5.1 AF273774-1|AAG15123.1| 433|Caenorhabditis elegans nuclear recep... 28 5.1 U55374-8|AAB36868.3| 1538|Caenorhabditis elegans Uncoordinated p... 27 9.0 U55374-6|AAM69092.1| 1926|Caenorhabditis elegans Uncoordinated p... 27 9.0 U55374-5|AAP82640.2| 2027|Caenorhabditis elegans Uncoordinated p... 27 9.0 AY264781-1|AAP13107.1| 2027|Caenorhabditis elegans high voltage ... 27 9.0 >Z70684-7|CAA94601.1| 143|Caenorhabditis elegans Hypothetical protein F28D1.7 protein. Length = 143 Score = 132 bits (318), Expect = 2e-31 Identities = 57/65 (87%), Positives = 63/65 (96%) Frame = +3 Query: 54 HRREQRWADKEFKKAHMGTKWKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLI 233 HR+EQRW DK +KKAH+GT+WK+NPFGGASHAKGIVLEK+GVEAKQPNSAIRKCVRVQLI Sbjct: 16 HRQEQRWNDKRYKKAHIGTRWKSNPFGGASHAKGIVLEKIGVEAKQPNSAIRKCVRVQLI 75 Query: 234 KNGKK 248 KNGKK Sbjct: 76 KNGKK 80 Score = 78.6 bits (185), Expect = 3e-15 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = +1 Query: 310 VAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 435 V+GFGR GHAVGDIPGVRFK+VKVAN SL+AL+K KKERPRS Sbjct: 102 VSGFGRSGHAVGDIPGVRFKIVKVANTSLIALFKGKKERPRS 143 Score = 35.9 bits (79), Expect = 0.019 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = +2 Query: 242 KESDPFVPRDGCLNHIEENDE 304 K+ FVP DGCLN +EENDE Sbjct: 79 KKITAFVPNDGCLNFVEENDE 99 >Z92838-1|CAB07406.1| 157|Caenorhabditis elegans Hypothetical protein T03D8.2 protein. Length = 157 Score = 35.5 bits (78), Expect = 0.026 Identities = 18/32 (56%), Positives = 21/32 (65%) Frame = +3 Query: 135 GASHAKGIVLEKVGVEAKQPNSAIRKCVRVQL 230 G SH KGIVL+ V K+PNS RKC V+L Sbjct: 72 GYSHYKGIVLKTVIRHPKKPNSGNRKCAIVRL 103 >Z81128-8|CAB03402.1| 811|Caenorhabditis elegans Hypothetical protein T23D8.9a protein. Length = 811 Score = 28.7 bits (61), Expect = 2.9 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = +2 Query: 254 PFVPRDGCLNHIEEN 298 PFVP+DG LN I+EN Sbjct: 654 PFVPKDGVLNVIDEN 668 >Z70204-5|CAI46566.1| 379|Caenorhabditis elegans Hypothetical protein C11G6.4b protein. Length = 379 Score = 27.9 bits (59), Expect = 5.1 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -1 Query: 530 VHNIYYVQDFTFYELINNALPDSRXLITMYT 438 V N+Y V++ TFYEL++ L DS T T Sbjct: 301 VFNVYSVEE-TFYELVSGRLSDSFFQTTQLT 330 >Z70204-4|CAA94114.2| 437|Caenorhabditis elegans Hypothetical protein C11G6.4a protein. Length = 437 Score = 27.9 bits (59), Expect = 5.1 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -1 Query: 530 VHNIYYVQDFTFYELINNALPDSRXLITMYT 438 V N+Y V++ TFYEL++ L DS T T Sbjct: 359 VFNVYSVEE-TFYELVSGRLSDSFFQTTQLT 388 >AY305832-1|AAR11977.1| 437|Caenorhabditis elegans nuclear receptor NHR-28 protein. Length = 437 Score = 27.9 bits (59), Expect = 5.1 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -1 Query: 530 VHNIYYVQDFTFYELINNALPDSRXLITMYT 438 V N+Y V++ TFYEL++ L DS T T Sbjct: 359 VFNVYSVEE-TFYELVSGRLSDSFFQTTQLT 388 >AY305831-1|AAR11976.1| 437|Caenorhabditis elegans nuclear receptor NHR-28 protein. Length = 437 Score = 27.9 bits (59), Expect = 5.1 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -1 Query: 530 VHNIYYVQDFTFYELINNALPDSRXLITMYT 438 V N+Y V++ TFYEL++ L DS T T Sbjct: 359 VFNVYSVEE-TFYELVSGRLSDSFFQTTQLT 388 >AF273775-1|AAG15124.1| 383|Caenorhabditis elegans nuclear receptor NHR-28 protein. Length = 383 Score = 27.9 bits (59), Expect = 5.1 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -1 Query: 530 VHNIYYVQDFTFYELINNALPDSRXLITMYT 438 V N+Y V++ TFYEL++ L DS T T Sbjct: 305 VFNVYSVEE-TFYELVSGRLSDSFFQTTQLT 334 >AF273774-1|AAG15123.1| 433|Caenorhabditis elegans nuclear receptor NHR-28 protein. Length = 433 Score = 27.9 bits (59), Expect = 5.1 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -1 Query: 530 VHNIYYVQDFTFYELINNALPDSRXLITMYT 438 V N+Y V++ TFYEL++ L DS T T Sbjct: 355 VFNVYSVEE-TFYELVSGRLSDSFFQTTQLT 384 >U55374-8|AAB36868.3| 1538|Caenorhabditis elegans Uncoordinated protein 2, isoform a protein. Length = 1538 Score = 27.1 bits (57), Expect = 9.0 Identities = 22/67 (32%), Positives = 30/67 (44%), Gaps = 7/67 (10%) Frame = -2 Query: 193 GCLASTPTFSRTMPFA*DAPPKGLAFHF-VPMWAFLNSL---SAHRCSRRWFTS---YAP 35 GC S F + + K F++ V FLN+ S H +WFT YA Sbjct: 366 GCCHSVGKFIKQLRIQIRIMVKTQIFYWSVITLVFLNTCCVASEHYGQPQWFTDFLKYAE 425 Query: 34 FVFLGVY 14 FVFLG++ Sbjct: 426 FVFLGIF 432 >U55374-6|AAM69092.1| 1926|Caenorhabditis elegans Uncoordinated protein 2, isoform c protein. Length = 1926 Score = 27.1 bits (57), Expect = 9.0 Identities = 22/67 (32%), Positives = 30/67 (44%), Gaps = 7/67 (10%) Frame = -2 Query: 193 GCLASTPTFSRTMPFA*DAPPKGLAFHF-VPMWAFLNSL---SAHRCSRRWFTS---YAP 35 GC S F + + K F++ V FLN+ S H +WFT YA Sbjct: 366 GCCHSVGKFIKQLRIQIRIMVKTQIFYWSVITLVFLNTCCVASEHYGQPQWFTDFLKYAE 425 Query: 34 FVFLGVY 14 FVFLG++ Sbjct: 426 FVFLGIF 432 >U55374-5|AAP82640.2| 2027|Caenorhabditis elegans Uncoordinated protein 2, isoform b protein. Length = 2027 Score = 27.1 bits (57), Expect = 9.0 Identities = 22/67 (32%), Positives = 30/67 (44%), Gaps = 7/67 (10%) Frame = -2 Query: 193 GCLASTPTFSRTMPFA*DAPPKGLAFHF-VPMWAFLNSL---SAHRCSRRWFTS---YAP 35 GC S F + + K F++ V FLN+ S H +WFT YA Sbjct: 500 GCCHSVGKFIKQLRIQIRIMVKTQIFYWSVITLVFLNTCCVASEHYGQPQWFTDFLKYAE 559 Query: 34 FVFLGVY 14 FVFLG++ Sbjct: 560 FVFLGIF 566 >AY264781-1|AAP13107.1| 2027|Caenorhabditis elegans high voltage activated calciumchannel alpha-1 subunit protein. Length = 2027 Score = 27.1 bits (57), Expect = 9.0 Identities = 22/67 (32%), Positives = 30/67 (44%), Gaps = 7/67 (10%) Frame = -2 Query: 193 GCLASTPTFSRTMPFA*DAPPKGLAFHF-VPMWAFLNSL---SAHRCSRRWFTS---YAP 35 GC S F + + K F++ V FLN+ S H +WFT YA Sbjct: 500 GCCHSVGKFIKQLRIQIRIMVKTQIFYWSVITLVFLNTCCVASEHYGQPQWFTDFLKYAE 559 Query: 34 FVFLGVY 14 FVFLG++ Sbjct: 560 FVFLGIF 566 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,196,810 Number of Sequences: 27780 Number of extensions: 284337 Number of successful extensions: 573 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 550 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 573 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1123720628 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -