BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30643.Seq (748 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 25 1.00 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 25 1.00 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 25 1.00 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 22 5.3 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 7.0 S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor prot... 21 9.3 S76956-1|AAB33931.1| 168|Apis mellifera olfactory receptor prot... 21 9.3 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 21 9.3 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 21 9.3 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 21 9.3 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 21 9.3 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 24.6 bits (51), Expect = 1.00 Identities = 13/55 (23%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = +3 Query: 234 RRSGYPSRVWQWASWSDSELLPASCAWVFPY-LGIMQFNKQNVERAKSDLLAALK 395 R SG ++ +W +WS+ +L Y + +E+++ D L A+K Sbjct: 377 RNSGATDKIIRWCTWSEGDLEKCKALTRAAYSRDVRPKYDCTLEKSQDDCLKAIK 431 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 24.6 bits (51), Expect = 1.00 Identities = 13/55 (23%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = +3 Query: 234 RRSGYPSRVWQWASWSDSELLPASCAWVFPY-LGIMQFNKQNVERAKSDLLAALK 395 R SG ++ +W +WS+ +L Y + +E+++ D L A+K Sbjct: 377 RNSGATDKIIRWCTWSEGDLEKCKALTRAAYSRDVRPKYDCTLEKSQDDCLKAIK 431 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 24.6 bits (51), Expect = 1.00 Identities = 13/55 (23%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = +3 Query: 234 RRSGYPSRVWQWASWSDSELLPASCAWVFPY-LGIMQFNKQNVERAKSDLLAALK 395 R SG ++ +W +WS+ +L Y + +E+++ D L A+K Sbjct: 377 RNSGATDKIIRWCTWSEGDLEKCKALTRAAYSRDVRPKYDCTLEKSQDDCLKAIK 431 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/31 (29%), Positives = 14/31 (45%) Frame = +3 Query: 84 FRIWRDQQVRRLLEEVSCRKSACIRKCRWKG 176 F IWRD ++ E + +A + W G Sbjct: 32 FEIWRDSLPTKMRELNATACAALYERVEWSG 62 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.8 bits (44), Expect = 7.0 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +1 Query: 10 PENFRAYKALIAAQYSGTDVKVA 78 PE+F A ALI+ Q G + VA Sbjct: 1620 PEHFVASYALISNQCEGDSLNVA 1642 >S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor protein. Length = 169 Score = 21.4 bits (43), Expect = 9.3 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = -2 Query: 690 HTSYLFCPPSCSVHQLTP 637 HT+ FC P C + + P Sbjct: 39 HTTNAFCLPFCGPNVINP 56 >S76956-1|AAB33931.1| 168|Apis mellifera olfactory receptor protein. Length = 168 Score = 21.4 bits (43), Expect = 9.3 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = -2 Query: 690 HTSYLFCPPSCSVHQLTP 637 HT+ FC P C + + P Sbjct: 38 HTTNAFCLPFCGPNVINP 55 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 21.4 bits (43), Expect = 9.3 Identities = 12/46 (26%), Positives = 19/46 (41%) Frame = -2 Query: 267 TARHGLGSQISSAETFIGNVVSDGIAFS*KHLSIGTFECRHFSGRK 130 T +G S + V DG+ + S+ F C ++ GRK Sbjct: 345 TTSNGFRSTLPVVSNLTAMNVWDGVCMCFIYASLLEFVCVNYVGRK 390 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 21.4 bits (43), Expect = 9.3 Identities = 12/46 (26%), Positives = 19/46 (41%) Frame = -2 Query: 267 TARHGLGSQISSAETFIGNVVSDGIAFS*KHLSIGTFECRHFSGRK 130 T +G S + V DG+ + S+ F C ++ GRK Sbjct: 314 TTSNGFRSTLPVVSNLTAMNVWDGVCMCFIYASLLEFVCVNYVGRK 359 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 21.4 bits (43), Expect = 9.3 Identities = 12/46 (26%), Positives = 19/46 (41%) Frame = -2 Query: 267 TARHGLGSQISSAETFIGNVVSDGIAFS*KHLSIGTFECRHFSGRK 130 T +G S + V DG+ + S+ F C ++ GRK Sbjct: 365 TTSNGFRSTLPVVSNLTAMNVWDGVCMCFIYASLLEFVCVNYVGRK 410 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 21.4 bits (43), Expect = 9.3 Identities = 12/46 (26%), Positives = 19/46 (41%) Frame = -2 Query: 267 TARHGLGSQISSAETFIGNVVSDGIAFS*KHLSIGTFECRHFSGRK 130 T +G S + V DG+ + S+ F C ++ GRK Sbjct: 314 TTSNGFRSTLPVVSNLTAMNVWDGVCMCFIYASLLEFVCVNYVGRK 359 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 209,213 Number of Sequences: 438 Number of extensions: 4953 Number of successful extensions: 12 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23388480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -