BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30642.Seq (698 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8111| Best HMM Match : Cpn60_TCP1 (HMM E-Value=0) 87 1e-17 SB_25097| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_25096| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_52637| Best HMM Match : Cpn60_TCP1 (HMM E-Value=0) 79 5e-15 SB_30876| Best HMM Match : Ribosomal_S16 (HMM E-Value=7.1) 71 1e-12 SB_57454| Best HMM Match : DUF924 (HMM E-Value=1) 70 2e-12 SB_3960| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_4934| Best HMM Match : NAD_binding_2 (HMM E-Value=4.8) 52 6e-07 SB_22388| Best HMM Match : Extensin_2 (HMM E-Value=0.086) 47 2e-05 SB_56262| Best HMM Match : Cpn60_TCP1 (HMM E-Value=6.6e-15) 36 0.024 SB_3351| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_29096| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_49248| Best HMM Match : Cpn60_TCP1 (HMM E-Value=1.6) 29 4.8 SB_20222| Best HMM Match : SSF (HMM E-Value=0.0045) 29 4.8 SB_25900| Best HMM Match : fn3 (HMM E-Value=2e-17) 28 6.3 SB_41312| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 >SB_8111| Best HMM Match : Cpn60_TCP1 (HMM E-Value=0) Length = 531 Score = 87.4 bits (207), Expect = 1e-17 Identities = 37/72 (51%), Positives = 59/72 (81%) Frame = +3 Query: 249 IKMLEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 428 +K + +++PAAK+LVEL+++QD+EVGDGTTSV ++ +ELLK A++LV KIHP +I++G+ Sbjct: 68 LKSIGIDNPAAKILVELSKVQDDEVGDGTTSVTVLTSELLKEAEKLVSCKIHPQTIVAGW 127 Query: 429 RLACKEAVKYIQ 464 R + K A K ++ Sbjct: 128 RKSVKAAEKALE 139 Score = 47.2 bits (107), Expect = 1e-05 Identities = 24/41 (58%), Positives = 31/41 (75%), Gaps = 2/41 (4%) Frame = +1 Query: 139 AAAIANIVKSSLGPVGLDKML--VDDIGDVTVTNDGATILK 255 A AI ++VKS+LGP G+DK+L G++ VTNDGATILK Sbjct: 29 AIAIGDLVKSTLGPKGMDKILQSFGQNGNIQVTNDGATILK 69 Score = 33.1 bits (72), Expect = 0.22 Identities = 15/44 (34%), Positives = 27/44 (61%) Frame = +2 Query: 473 HSNSRVTWQAVSINTAKTTMSSKLIGADADFFSEMVVDAAQAIK 604 HS+ ++ +N A+TT+SSK++ D F+++ VDA +K Sbjct: 145 HSSDPEKFREDLMNIARTTLSSKILVQHRDHFAKLAVDAVLRLK 188 >SB_25097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 80.6 bits (190), Expect = 1e-15 Identities = 32/75 (42%), Positives = 56/75 (74%) Frame = +3 Query: 249 IKMLEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 428 ++ ++V+HPAAK ++E+++ QDEEVGDGTTSV+I+A E + A+ ++ ++HPT II+ Y Sbjct: 9 LREIQVKHPAAKSMIEISRTQDEEVGDGTTSVIILAGEFMSVAEPFLEQQMHPTQIIAAY 68 Query: 429 RLACKEAVKYIQDNL 473 RLA + + ++ + Sbjct: 69 RLAMDDMIDILKQQI 83 >SB_25096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 315 Score = 79.8 bits (188), Expect = 2e-15 Identities = 32/72 (44%), Positives = 54/72 (75%) Frame = +3 Query: 258 LEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLA 437 ++V+HPAAK ++E+++ QDEEVGDGTTSV+I+A E + A+ ++ ++HPT II+ YRLA Sbjct: 209 IQVKHPAAKSMIEISRTQDEEVGDGTTSVIILAGEFMSVAEPFLEQQMHPTQIIAAYRLA 268 Query: 438 CKEAVKYIQDNL 473 + + ++ + Sbjct: 269 MDDMIDILKQQI 280 >SB_52637| Best HMM Match : Cpn60_TCP1 (HMM E-Value=0) Length = 505 Score = 78.6 bits (185), Expect = 5e-15 Identities = 42/93 (45%), Positives = 63/93 (67%), Gaps = 6/93 (6%) Frame = +3 Query: 255 MLEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRL 434 M+EV+H AK++VEL++ QD E+GDGTT VV++A LL++A++L+ IHP I GY L Sbjct: 78 MMEVDHQIAKLMVELSKSQDNEIGDGTTGVVVLAGALLEHAEQLLDWGIHPIRIADGYEL 137 Query: 435 ACKEAVKY---IQDNLTV---TVESLGRPSLST 515 A K A+++ I DN V ESL + +++T Sbjct: 138 AAKIALEHMDSIADNFPVDKDNKESLIQTAMTT 170 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = +1 Query: 139 AAAIANIVKSSLGPVGLDKMLVDDIGDVTVTNDGATIL 252 A A+A+I+K+SLGP G+DKM+V G+VTVTNDGATIL Sbjct: 39 ARAVASILKTSLGPKGMDKMMVSPDGEVTVTNDGATIL 76 >SB_30876| Best HMM Match : Ribosomal_S16 (HMM E-Value=7.1) Length = 131 Score = 70.5 bits (165), Expect = 1e-12 Identities = 31/58 (53%), Positives = 39/58 (67%) Frame = +2 Query: 509 INTAKTTMSSKLIGADADFFSEMVVDAAQAIKTMNPRGNTIYPIKAINILKAHGPECK 682 ++ A T +SSKLIG DFF+ M+VDA A+K +G YPIKAIN+LKAHG K Sbjct: 14 VSAANTALSSKLIGQQGDFFANMIVDAVMAVKRTGNKGEAKYPIKAINVLKAHGGSAK 71 >SB_57454| Best HMM Match : DUF924 (HMM E-Value=1) Length = 144 Score = 69.7 bits (163), Expect = 2e-12 Identities = 30/56 (53%), Positives = 46/56 (82%) Frame = +3 Query: 297 LAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAVKYIQ 464 L+++QD+EVGDGTTSV ++A+ELLK A++LV KIHP +I++G+R + K A K ++ Sbjct: 2 LSKVQDDEVGDGTTSVTVLASELLKEAEKLVSCKIHPQTIVAGWRKSVKAAEKALE 57 Score = 32.7 bits (71), Expect = 0.29 Identities = 15/44 (34%), Positives = 27/44 (61%) Frame = +2 Query: 473 HSNSRVTWQAVSINTAKTTMSSKLIGADADFFSEMVVDAAQAIK 604 HS+ ++ +N A+TT+SSK++ D F+++ VDA +K Sbjct: 63 HSSDPEKFRDDLMNIARTTLSSKILVQHRDHFAKLAVDAVLRLK 106 >SB_3960| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 762 Score = 64.1 bits (149), Expect = 1e-10 Identities = 27/75 (36%), Positives = 48/75 (64%) Frame = +3 Query: 243 HNIKMLEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIIS 422 + ++ +++HP A ++ +A QD+ GDGTTS V+I ELLK AD V +HP + Sbjct: 164 NGVQNSQIQHPTASLIARVATAQDDITGDGTTSNVMIIGELLKQADLYVSEGLHPRLVTE 223 Query: 423 GYRLACKEAVKYIQD 467 G+ +A K+A++ +++ Sbjct: 224 GFEVAKKKALEVLEE 238 Score = 29.1 bits (62), Expect = 3.6 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +2 Query: 509 INTAKTTMSSKLIGADADFFSEMVVDAAQAIK 604 IN AKT++ +K+ AD +E+VVDA I+ Sbjct: 251 INVAKTSLRTKVRTELADLLTEVVVDAVLTIR 282 >SB_4934| Best HMM Match : NAD_binding_2 (HMM E-Value=4.8) Length = 186 Score = 51.6 bits (118), Expect = 6e-07 Identities = 22/37 (59%), Positives = 30/37 (81%) Frame = +1 Query: 139 AAAIANIVKSSLGPVGLDKMLVDDIGDVTVTNDGATI 249 A A+A+ +++SLGP G+DKM+ GDVT+TNDGATI Sbjct: 33 AKAVADAIRTSLGPKGMDKMIQGGNGDVTITNDGATI 69 >SB_22388| Best HMM Match : Extensin_2 (HMM E-Value=0.086) Length = 724 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/35 (54%), Positives = 29/35 (82%) Frame = +1 Query: 148 IANIVKSSLGPVGLDKMLVDDIGDVTVTNDGATIL 252 IA+ V+++LGP G+DK++VD G T++NDGATI+ Sbjct: 667 IADAVRTTLGPRGMDKLIVDGRGKATISNDGATII 701 Score = 32.7 bits (71), Expect = 0.29 Identities = 13/24 (54%), Positives = 19/24 (79%) Frame = +3 Query: 249 IKMLEVEHPAAKVLVELAQLQDEE 320 I +L++ HPAAK LV++A+ QD E Sbjct: 701 INLLDIVHPAAKTLVDIAKSQDAE 724 >SB_56262| Best HMM Match : Cpn60_TCP1 (HMM E-Value=6.6e-15) Length = 563 Score = 36.3 bits (80), Expect = 0.024 Identities = 16/33 (48%), Positives = 22/33 (66%) Frame = +1 Query: 157 IVKSSLGPVGLDKMLVDDIGDVTVTNDGATILK 255 I+K S GP GLD ML G++ +TN G+ IL+ Sbjct: 15 ILKKSFGPNGLDVMLRSSSGNILITNSGSMILE 47 >SB_3351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 33.9 bits (74), Expect = 0.13 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +2 Query: 518 AKTTMSSKLIGADADFFSEMVVDAAQAIKTMNP 616 A T +SSKLI +FF++MVVDA + + P Sbjct: 28 AATALSSKLIATQKEFFAKMVVDAVMMLDELLP 60 >SB_29096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 41 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/38 (28%), Positives = 23/38 (60%) Frame = +3 Query: 360 ELLKNADELVKTKIHPTSIISGYRLACKEAVKYIQDNL 473 E + A+ ++ ++HPT II+ YRLA + + ++ + Sbjct: 3 EFMSVAEPFLEQQMHPTQIIAAYRLAMDDMIDILKQQI 40 >SB_49248| Best HMM Match : Cpn60_TCP1 (HMM E-Value=1.6) Length = 278 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +1 Query: 148 IANIVKSSLGPVGLDKMLVDDIGDVTVTNDGATILK 255 +A+ V +LGP G + ++ G +T DG T+ K Sbjct: 79 LADAVAVTLGPKGKNVIIEQSFGGPKITKDGVTVAK 114 Score = 28.3 bits (60), Expect = 6.3 Identities = 13/48 (27%), Positives = 25/48 (52%) Frame = +3 Query: 279 AKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIIS 422 A+++ ++A +EE GDGTT+ ++A + V +P + S Sbjct: 127 ARLVQDVANNTNEEAGDGTTTATVLARSIATEGFLHVSKGANPQEVSS 174 >SB_20222| Best HMM Match : SSF (HMM E-Value=0.0045) Length = 471 Score = 28.7 bits (61), Expect = 4.8 Identities = 17/60 (28%), Positives = 29/60 (48%) Frame = -3 Query: 687 FPLHSGPWAFRMLIALIGYIVFPLGFIVLIACAASTTISEKKSASAPISLDDMVVLAVLI 508 FP+ GPW L+ G I + + F +++C + S S +A + M + AV+I Sbjct: 186 FPVQPGPWIDFALLLTFGGIPWQVYFQRVLSC-KTVNASRNLSLAAAVGCIIMAIPAVII 244 >SB_25900| Best HMM Match : fn3 (HMM E-Value=2e-17) Length = 197 Score = 28.3 bits (60), Expect = 6.3 Identities = 17/50 (34%), Positives = 26/50 (52%) Frame = +3 Query: 312 DEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAVKYI 461 DE+V DG I+AAE + + + PTS+ +GY +A V+ I Sbjct: 98 DEDVPDGAP---IVAAEAVNSTSLRINCTTLPTSVANGYVIAFNVYVESI 144 >SB_41312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 357 Score = 27.9 bits (59), Expect = 8.4 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 7/62 (11%) Frame = +2 Query: 518 AKTTMSSKLIGADADFFSEMV-------VDAAQAIKTMNPRGNTIYPIKAINILKAHGPE 676 AK T S+ GA+ D+ ++ + D AQ IK P GNT++ + + H Sbjct: 11 AKQTGSALRCGANIDYKNDQIGCGYYFTTDQAQCIKEYIPEGNTVFDFP---VCEGHNLI 67 Query: 677 CK 682 CK Sbjct: 68 CK 69 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,646,297 Number of Sequences: 59808 Number of extensions: 442776 Number of successful extensions: 1015 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 902 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1014 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -