BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30641.Seq (797 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC57A10.09c |||High-mobility group non-histone chromatin prote... 41 2e-04 SPBC28F2.11 |||INO80 complex subunit |Schizosaccharomyces pombe|... 37 0.003 SPBC23G7.09 |matmc_2|matmc|mating-type m-specific polypeptide mc... 36 0.005 SPBC1711.02 |matmc_1|matmc|mating-type m-specific polypeptide mc... 36 0.005 SPBP8B7.27 |mug30||ubiquitin-protein ligase E3|Schizosaccharomyc... 29 0.77 SPCC330.09 |||rRNA processing protein Enp2 |Schizosaccharomyces ... 28 1.8 SPAC1687.10 |mcp1||sequence orphan|Schizosaccharomyces pombe|chr... 27 3.1 SPAC21E11.05c |cyp8||cyclophilin family peptidyl-prolyl cis-tran... 27 3.1 SPCC23B6.03c |tel1||ATM checkpoint kinase|Schizosaccharomyces po... 26 7.2 SPBC713.02c |ubp21|ubpD, ubp15|ubiquitin C-terminal hydrolase Ub... 26 7.2 SPBC1347.02 |fkbp39||FKBP-type peptidyl-prolyl cis-trans isomera... 25 9.5 >SPAC57A10.09c |||High-mobility group non-histone chromatin protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 108 Score = 40.7 bits (91), Expect = 2e-04 Identities = 20/63 (31%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = +3 Query: 84 KMTDKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSM--YDKSEWEEKAQ 257 K + PKR MSA++ + R K+K DNP ++ G+ W+ + ++ +EEKA+ Sbjct: 11 KDPNTPKRNMSAFMFFSIENREKMKTDNPDATFGQLGSLLGKRWKELTSTEREPYEEKAR 70 Query: 258 KPK 266 + K Sbjct: 71 QDK 73 >SPBC28F2.11 |||INO80 complex subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 310 Score = 37.1 bits (82), Expect = 0.003 Identities = 23/59 (38%), Positives = 33/59 (55%), Gaps = 4/59 (6%) Frame = +3 Query: 96 KPKRPMSAYLLWLNSARSKIKDD--NPGLKVTEIAKKAGEIWRSMY--DKSEWEEKAQK 260 +PKRP SAY L+ + RS+IK+ V E+ K E W S+ D+ +EE+A K Sbjct: 116 QPKRPPSAYNLFQKNQRSEIKESLGEKSNDVKEVNKAMHEKWGSLSEDDRKTYEEEASK 174 >SPBC23G7.09 |matmc_2|matmc|mating-type m-specific polypeptide mc|Schizosaccharomyces pombe|chr 2|||Manual Length = 181 Score = 36.3 bits (80), Expect = 0.005 Identities = 12/44 (27%), Positives = 27/44 (61%) Frame = +3 Query: 90 TDKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRS 221 T++ RP +A++L+ + + NP + ++++K GE+WR+ Sbjct: 100 TERTPRPPNAFILYRKEKHATLLKSNPSINNSQVSKLVGEMWRN 143 >SPBC1711.02 |matmc_1|matmc|mating-type m-specific polypeptide mc|Schizosaccharomyces pombe|chr 2|||Manual Length = 181 Score = 36.3 bits (80), Expect = 0.005 Identities = 12/44 (27%), Positives = 27/44 (61%) Frame = +3 Query: 90 TDKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRS 221 T++ RP +A++L+ + + NP + ++++K GE+WR+ Sbjct: 100 TERTPRPPNAFILYRKEKHATLLKSNPSINNSQVSKLVGEMWRN 143 >SPBP8B7.27 |mug30||ubiquitin-protein ligase E3|Schizosaccharomyces pombe|chr 2|||Manual Length = 807 Score = 29.1 bits (62), Expect = 0.77 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = +1 Query: 616 SIYIFFNY*YNLEVYLYFYKGIILMKLHLFNVVSVSLLXPSGFIK 750 S Y++FNY + + Y++ ILM + + N +++ + P F K Sbjct: 503 SNYLWFNYSHRSKEIDYYHMSGILMGIAIHNSINLDVQMPRAFYK 547 >SPCC330.09 |||rRNA processing protein Enp2 |Schizosaccharomyces pombe|chr 3|||Manual Length = 634 Score = 27.9 bits (59), Expect = 1.8 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +1 Query: 319 REKKENPKTREESETGAKNKESETGRR 399 ++KK P R+E T K K+ GRR Sbjct: 598 KKKKSKPVNRDEDSTSGKKKQVTQGRR 624 >SPAC1687.10 |mcp1||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 661 Score = 27.1 bits (57), Expect = 3.1 Identities = 13/47 (27%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = -1 Query: 587 ELSN-KKVYYLNLSNKSQKEKKTFISWSEFKMINSKTLKLKYKFKEI 450 ELS+ +KVY++ + + +K ++S + ++ K + +FKEI Sbjct: 252 ELSSMRKVYFVKYKTEYEFLQKRYLSLARIMFVSKKEMLFTSQFKEI 298 >SPAC21E11.05c |cyp8||cyclophilin family peptidyl-prolyl cis-trans isomerase Cyp8|Schizosaccharomyces pombe|chr 1|||Manual Length = 516 Score = 27.1 bits (57), Expect = 3.1 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 301 KWRRSRREKKENPKTREESETGAKNKESETGR 396 +W++ RE KE K +EE E ++ S TGR Sbjct: 435 EWKKDERE-KEKRKRQEEEEENNLDRTSWTGR 465 >SPCC23B6.03c |tel1||ATM checkpoint kinase|Schizosaccharomyces pombe|chr 3|||Manual Length = 2812 Score = 25.8 bits (54), Expect = 7.2 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 Query: 503 ILTMK*MFFFLSGFCYLDLNNTLFCSITHNK 595 IL++K GFCYL L +F SI+ N+ Sbjct: 1063 ILSIKIEKSLYKGFCYLYLTLKVFLSISSNR 1093 >SPBC713.02c |ubp21|ubpD, ubp15|ubiquitin C-terminal hydrolase Ubp21|Schizosaccharomyces pombe|chr 2|||Manual Length = 1129 Score = 25.8 bits (54), Expect = 7.2 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 4/50 (8%) Frame = -2 Query: 247 SSHSLLSYMDLQISPAFLAISVTFNPGLS----SFIFDLALFNHNKYADI 110 +SH S +DL A + +TF P S + +FDL L H Y D+ Sbjct: 807 TSHPYKSALDLYDFMAHRVV-ITFEPRYSDDTNNGVFDLVLTTHTNYTDM 855 >SPBC1347.02 |fkbp39||FKBP-type peptidyl-prolyl cis-trans isomerase|Schizosaccharomyces pombe|chr 2|||Manual Length = 361 Score = 25.4 bits (53), Expect = 9.5 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +3 Query: 192 AKKAGEIWRSMYDKSEWEEKAQKPKNNT 275 AKKA + D+SE EE A KNNT Sbjct: 178 AKKAQVKKKRTKDESEQEEAASPKKNNT 205 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,755,357 Number of Sequences: 5004 Number of extensions: 52786 Number of successful extensions: 167 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 161 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 167 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 389395636 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -