BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30641.Seq (797 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12646| Best HMM Match : SSrecog (HMM E-Value=0) 85 5e-17 SB_21901| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_53304| Best HMM Match : HMG_box (HMM E-Value=1.9e-32) 50 2e-06 SB_42643| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 5e-06 SB_33348| Best HMM Match : HMG_box (HMM E-Value=3.2e-34) 49 5e-06 SB_13764| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_26162| Best HMM Match : HMG_box (HMM E-Value=1.5e-31) 46 5e-05 SB_15122| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_3516| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_24989| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_23256| Best HMM Match : HMG_box (HMM E-Value=3.3e-22) 43 3e-04 SB_16422| Best HMM Match : HMG_box (HMM E-Value=8.7e-26) 43 3e-04 SB_40969| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_41131| Best HMM Match : HMG_box (HMM E-Value=4.1e-28) 41 0.001 SB_29734| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_1832| Best HMM Match : HMG_box (HMM E-Value=1.7e-22) 41 0.001 SB_25642| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) 41 0.001 SB_10678| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) 41 0.001 SB_18968| Best HMM Match : HMG_box (HMM E-Value=1.2e-19) 40 0.002 SB_37758| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_8014| Best HMM Match : HMG_box (HMM E-Value=0.00031) 40 0.002 SB_2908| Best HMM Match : HMG_box (HMM E-Value=1.5e-08) 40 0.002 SB_52386| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_46509| Best HMM Match : HMG_box (HMM E-Value=4.2e-10) 39 0.004 SB_12182| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_31139| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.022 SB_16438| Best HMM Match : HMG_box (HMM E-Value=7.2e-31) 37 0.022 SB_57274| Best HMM Match : HMG_box (HMM E-Value=0.021) 35 0.066 SB_23680| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.088 SB_27742| Best HMM Match : HMG_box (HMM E-Value=1.3e-24) 34 0.12 SB_18120| Best HMM Match : Colipase_C (HMM E-Value=0.87) 32 0.47 SB_12387| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.62 SB_35037| Best HMM Match : Far-17a_AIG1 (HMM E-Value=4.6e-30) 31 0.82 SB_16481| Best HMM Match : HMG_box (HMM E-Value=1.2e-08) 31 1.1 SB_18060| Best HMM Match : Pepsin-I3 (HMM E-Value=0.67) 31 1.4 SB_36647| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_44844| Best HMM Match : DUF164 (HMM E-Value=0.094) 29 5.8 SB_24670| Best HMM Match : DivIC (HMM E-Value=2) 28 7.6 >SB_12646| Best HMM Match : SSrecog (HMM E-Value=0) Length = 783 Score = 85.4 bits (202), Expect = 5e-17 Identities = 35/57 (61%), Positives = 46/57 (80%) Frame = +3 Query: 84 KMTDKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYDKSEWEEKA 254 K + PKR MSAY+LWLN R +IKD NPG+ VTE++K AGE+W+++ DKS+WEEKA Sbjct: 537 KDPNAPKRAMSAYMLWLNDTRQEIKDKNPGISVTEVSKVAGEMWKNLTDKSKWEEKA 593 >SB_21901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 50.0 bits (114), Expect = 2e-06 Identities = 24/63 (38%), Positives = 38/63 (60%), Gaps = 2/63 (3%) Frame = +3 Query: 84 KMTDKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMY--DKSEWEEKAQ 257 K +KPKR +SAY ++N R +K DNP ++K GE+W M DK+++++ A+ Sbjct: 97 KDPNKPKRCLSAYFHFINLKRDDVKKDNPNASGGALSKVLGEMWSKMTDDDKTQYQDMAK 156 Query: 258 KPK 266 K K Sbjct: 157 KDK 159 Score = 35.1 bits (77), Expect = 0.066 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 2/63 (3%) Frame = +3 Query: 84 KMTDKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSM--YDKSEWEEKAQ 257 K +KPK SAY +L R K++ + + + +K + E W++M +K + +KA Sbjct: 7 KDPNKPKGAKSAYNFFLQDQREKLQREEGKFSLADFSKVSAEKWKNMSEEEKETFVQKAG 66 Query: 258 KPK 266 K K Sbjct: 67 KDK 69 >SB_53304| Best HMM Match : HMG_box (HMM E-Value=1.9e-32) Length = 398 Score = 50.0 bits (114), Expect = 2e-06 Identities = 25/71 (35%), Positives = 44/71 (61%), Gaps = 4/71 (5%) Frame = +3 Query: 60 IKIHI*GFKMTDKP--KRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYD- 230 + + + G K T KP KRPM+A+++W +AR K+ D P L E++K G++W+ + D Sbjct: 50 LPVRVNGIK-TQKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWKLLNDS 108 Query: 231 -KSEWEEKAQK 260 K + E+A++ Sbjct: 109 EKKPFIEEAER 119 >SB_42643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 557 Score = 48.8 bits (111), Expect = 5e-06 Identities = 22/61 (36%), Positives = 37/61 (60%), Gaps = 2/61 (3%) Frame = +3 Query: 84 KMTDKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMY--DKSEWEEKAQ 257 K + KRPM+A+++W R KI +NP + +EI+K+ G W+ + DK + E+A+ Sbjct: 322 KPVEHVKRPMNAFMVWSREERRKIAQENPKMHNSEISKRLGSEWKQLADDDKKPFVEEAK 381 Query: 258 K 260 K Sbjct: 382 K 382 >SB_33348| Best HMM Match : HMG_box (HMM E-Value=3.2e-34) Length = 179 Score = 48.8 bits (111), Expect = 5e-06 Identities = 22/61 (36%), Positives = 37/61 (60%), Gaps = 2/61 (3%) Frame = +3 Query: 84 KMTDKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMY--DKSEWEEKAQ 257 K + KRPM+A+++W R KI +NP + +EI+K+ G W+ + DK + E+A+ Sbjct: 5 KPVEHVKRPMNAFMVWSREERRKIAQENPKMHNSEISKRLGSEWKQLADDDKKPFVEEAK 64 Query: 258 K 260 K Sbjct: 65 K 65 >SB_13764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1099 Score = 46.8 bits (106), Expect = 2e-05 Identities = 17/49 (34%), Positives = 32/49 (65%) Frame = +3 Query: 93 DKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYDKSE 239 D+ KRPM+A+++W R K+ DNP + +EI+K+ G W+ + ++ + Sbjct: 787 DRVKRPMNAFMVWSRERRRKMAQDNPKMHNSEISKRLGSEWKLLSEQEK 835 >SB_26162| Best HMM Match : HMG_box (HMM E-Value=1.5e-31) Length = 367 Score = 45.6 bits (103), Expect = 5e-05 Identities = 20/55 (36%), Positives = 33/55 (60%), Gaps = 2/55 (3%) Frame = +3 Query: 102 KRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSM--YDKSEWEEKAQK 260 KRPM+++++W R K ++NP L EI+K G+ W + DK + EKA++ Sbjct: 95 KRPMNSFMIWAKVMRRKFAEENPKLHNAEISKLLGKAWNELTTKDKRPFVEKAER 149 >SB_15122| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 709 Score = 45.6 bits (103), Expect = 5e-05 Identities = 20/61 (32%), Positives = 37/61 (60%), Gaps = 2/61 (3%) Frame = +3 Query: 84 KMTDKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWR--SMYDKSEWEEKAQ 257 K K KRPM+++++W SAR K+ + P + E++K G++WR S +K + ++A Sbjct: 106 KKDPKVKRPMNSFMVWAQSARRKLAEQYPHVHNAELSKMLGKLWRMLSAAEKQPYVDEAA 165 Query: 258 K 260 + Sbjct: 166 R 166 >SB_3516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 642 Score = 44.4 bits (100), Expect = 1e-04 Identities = 17/45 (37%), Positives = 29/45 (64%) Frame = +3 Query: 90 TDKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSM 224 T++ KRPM+A+++W R ++ D NP L E++K G WR++ Sbjct: 363 TERIKRPMNAFMVWAQVERRRLADANPELHNAELSKMLGLTWRAL 407 >SB_24989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/61 (34%), Positives = 37/61 (60%), Gaps = 2/61 (3%) Frame = +3 Query: 84 KMTDKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMY--DKSEWEEKAQ 257 K D KRPM+AY++W R +I ++ P + +EI+K+ G W S+ +K + E+A+ Sbjct: 3 KPGDHIKRPMNAYMVWSRKERRRIAEECPRMLNSEISKRLGLEWNSLTLDEKQPYVEEAK 62 Query: 258 K 260 + Sbjct: 63 R 63 >SB_23256| Best HMM Match : HMG_box (HMM E-Value=3.3e-22) Length = 523 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/63 (31%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = +3 Query: 84 KMTDKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSM--YDKSEWEEKAQ 257 K + PK P++ Y+ +LN R K++ +NP L E+ + G +W + K + E+A+ Sbjct: 172 KDVNAPKAPLTGYVRFLNEHREKVRSENPDLPFHEVTRILGNMWSQLPTPQKQLFLEEAE 231 Query: 258 KPK 266 K K Sbjct: 232 KDK 234 >SB_16422| Best HMM Match : HMG_box (HMM E-Value=8.7e-26) Length = 245 Score = 42.7 bits (96), Expect = 3e-04 Identities = 20/61 (32%), Positives = 39/61 (63%), Gaps = 2/61 (3%) Frame = +3 Query: 90 TDKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSM--YDKSEWEEKAQKP 263 ++K KRP++A++LW R I ++NP + +I++K G W+ + +K+ + E+A+K Sbjct: 16 SEKIKRPLNAFILWSKKRRRVIANENPQMHNFDISRKLGLEWQKLTEEEKAYYFEEAKKL 75 Query: 264 K 266 K Sbjct: 76 K 76 >SB_40969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 42.3 bits (95), Expect = 4e-04 Identities = 18/54 (33%), Positives = 32/54 (59%), Gaps = 2/54 (3%) Frame = +3 Query: 102 KRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWR--SMYDKSEWEEKAQ 257 KRPM+ +++W R +I +NPG+ ++K G W+ S+ +K + EKA+ Sbjct: 9 KRPMNCFMVWSREKRCQILQENPGINNARLSKLLGMAWKKLSVEEKEPYIEKAK 62 >SB_41131| Best HMM Match : HMG_box (HMM E-Value=4.1e-28) Length = 245 Score = 41.1 bits (92), Expect = 0.001 Identities = 15/44 (34%), Positives = 27/44 (61%) Frame = +3 Query: 93 DKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSM 224 D KRP++++++W R + +NP ++ EI+K G+ WR M Sbjct: 8 DHVKRPLNSFMVWAKEKRRAMNRENPKMRNAEISKILGDEWRKM 51 >SB_29734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 304 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/55 (30%), Positives = 36/55 (65%), Gaps = 2/55 (3%) Frame = +3 Query: 102 KRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWR--SMYDKSEWEEKAQK 260 KRPM+A+++W R K+ +++P + EI+K+ G+ W+ S +K + E++++ Sbjct: 46 KRPMNAFMVWSQIERRKMAEEHPDMHNAEISKRLGKRWKLLSESEKRPFVEESER 100 >SB_1832| Best HMM Match : HMG_box (HMM E-Value=1.7e-22) Length = 299 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/60 (31%), Positives = 34/60 (56%), Gaps = 2/60 (3%) Frame = +3 Query: 93 DKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYD--KSEWEEKAQKPK 266 ++PK P+++Y + R+K+ P LK TE+A K + WR M + K + E+ ++ K Sbjct: 150 NQPKMPLTSYFRYCQKHRAKLAKKYPNLKSTELAAKLSKKWRKMSEERKKAYTEQYEEEK 209 Score = 36.7 bits (81), Expect = 0.022 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = +3 Query: 108 PMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYDKSE--WEEK 251 P+SA+ LW N AR + NP + ++ KK W+ + +K + W +K Sbjct: 230 PLSAFELWANQARKDLLVSNPDISAKKLKKKLKRKWKEIDEKGKKTWIKK 279 >SB_25642| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) Length = 267 Score = 40.7 bits (91), Expect = 0.001 Identities = 15/41 (36%), Positives = 27/41 (65%) Frame = +3 Query: 102 KRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSM 224 KRPM+A+++W + R ++ +NP L ++I+K G WR + Sbjct: 8 KRPMNAFMIWSSKKRRQLAAENPKLHNSQISKMLGTEWRKL 48 >SB_10678| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) Length = 494 Score = 40.7 bits (91), Expect = 0.001 Identities = 15/41 (36%), Positives = 27/41 (65%) Frame = +3 Query: 102 KRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSM 224 KRPM+A+++W + R ++ +NP L ++I+K G WR + Sbjct: 8 KRPMNAFMIWSSKKRRQLAAENPKLHNSQISKMLGTEWRKL 48 >SB_18968| Best HMM Match : HMG_box (HMM E-Value=1.2e-19) Length = 1204 Score = 40.3 bits (90), Expect = 0.002 Identities = 15/52 (28%), Positives = 32/52 (61%) Frame = +3 Query: 84 KMTDKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYDKSE 239 K+ +P +P+SAY ++ ++ I+ NP + EIAK G++W ++ ++ + Sbjct: 920 KIEGEPPKPLSAYQIFFKETQAAIRLQNPSAQFGEIAKIVGQMWENLPEEQK 971 >SB_37758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 382 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/63 (33%), Positives = 37/63 (58%), Gaps = 5/63 (7%) Frame = +3 Query: 93 DKPKRPMSAYLLW---LNSARSKIKDDNPGLKVTEIAKKAGEIWRSMY--DKSEWEEKAQ 257 +KPK P++ Y+ + LNS R +K +P L EI K G+ W S+ +K ++ ++A+ Sbjct: 192 NKPKAPVTGYVHYVRFLNSRRESVKHQHPHLTFPEITKMLGQEWNSLLPEEKQKFLDEAE 251 Query: 258 KPK 266 + K Sbjct: 252 EDK 254 >SB_8014| Best HMM Match : HMG_box (HMM E-Value=0.00031) Length = 406 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/57 (28%), Positives = 32/57 (56%), Gaps = 2/57 (3%) Frame = +3 Query: 93 DKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSM--YDKSEWEEKAQ 257 D+ + + + LWL R +I+++NP + ++ K A + W+ + +K W EKA+ Sbjct: 327 DRQTKKKNGFSLWLEENRDQIEEENPDIPDEDVVKIAMKTWKGLDSVEKKVWNEKAK 383 >SB_2908| Best HMM Match : HMG_box (HMM E-Value=1.5e-08) Length = 324 Score = 39.9 bits (89), Expect = 0.002 Identities = 14/50 (28%), Positives = 29/50 (58%) Frame = +3 Query: 99 PKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYDKSEWEE 248 P++P+ Y+ + ++K+ NP K+ +I K G++WR + D + +E Sbjct: 28 PEKPLMPYMRYSRKVWDQVKNQNPDFKLWDIGKIIGQMWRDLDDAEKQQE 77 >SB_52386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 384 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = +3 Query: 96 KPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYDKSE 239 K KRPM+A+++W RS I P EI+ + GEIW + + + Sbjct: 100 KVKRPMNAFMIWARLHRSTIAKRYPQANNAEISIRLGEIWNDLSSEQQ 147 >SB_46509| Best HMM Match : HMG_box (HMM E-Value=4.2e-10) Length = 145 Score = 39.1 bits (87), Expect = 0.004 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 2/54 (3%) Frame = +3 Query: 102 KRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWR--SMYDKSEWEEKAQ 257 KR S YLL+ + R I+ ++P EI++ GE WR S K+E+E KAQ Sbjct: 36 KRGQSGYLLFSHEMRGIIRKEHPEYAFGEISRLIGEEWRNASAARKAEYENKAQ 89 >SB_12182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1361 Score = 39.1 bits (87), Expect = 0.004 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 2/54 (3%) Frame = +3 Query: 102 KRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWR--SMYDKSEWEEKAQ 257 KR S YLL+ + R I+ ++P EI++ GE WR S K+E+E KAQ Sbjct: 1269 KRGQSGYLLFSHEMRGIIRKEHPEYAFGEISRLIGEEWRNASAARKAEYENKAQ 1322 >SB_31139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 315 Score = 36.7 bits (81), Expect = 0.022 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 2/55 (3%) Frame = +3 Query: 102 KRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYD--KSEWEEKAQK 260 KRPM+A+++W R + P + +EI+K G W++M D K + EKA++ Sbjct: 10 KRPMNAFMVWSKERRRIKSQECPRMHNSEISKILGCEWKAMKDELKQPYIEKAKE 64 >SB_16438| Best HMM Match : HMG_box (HMM E-Value=7.2e-31) Length = 690 Score = 36.7 bits (81), Expect = 0.022 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 2/54 (3%) Frame = +3 Query: 84 KMTDKPKRPMSAYLLWLNSARSKI--KDDNPGLKVTEIAKKAGEIWRSMYDKSE 239 K DKPKRP +AY L+L + R ++ K G K+ + AGE WR M D+ + Sbjct: 572 KDPDKPKRPPTAYFLFLAAFRKEMAGKALEDGKKIPSL---AGERWREMSDEDK 622 Score = 34.7 bits (76), Expect = 0.088 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 7/66 (10%) Frame = +3 Query: 102 KRPMSAYLLWLNSARSKIK-----DDNPGLKVTEIAKKAGEIWRSMYD--KSEWEEKAQK 260 KR SAY+ + + R+K+K P K E+AK AGE W+ + D K + KA+ Sbjct: 497 KRASSAYIHFTSDFRAKLKAKSAKSGTPLPKANEVAKLAGEEWKKLNDEQKKPYVAKAEA 556 Query: 261 PKNNTL 278 K L Sbjct: 557 DKQRYL 562 >SB_57274| Best HMM Match : HMG_box (HMM E-Value=0.021) Length = 200 Score = 35.1 bits (77), Expect = 0.066 Identities = 16/62 (25%), Positives = 34/62 (54%) Frame = +3 Query: 93 DKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYDKSEWEEKAQKPKNN 272 D+ + + + LWL R +I+++NP + ++ K A + W+ + E+K +K ++ Sbjct: 34 DRQTKKKNGFSLWLEENRDQIEEENPDIPDEDVVKIAMKTWKGL---DSVEKKLEKCYDD 90 Query: 273 TL 278 TL Sbjct: 91 TL 92 >SB_23680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 34.7 bits (76), Expect = 0.088 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +3 Query: 96 KPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSM 224 K KRP A+ + K+K++NP LK EI K + W ++ Sbjct: 305 KHKRPTPAFFRFRQDYADKVKEENPHLKDAEIRKHLSDQWANL 347 Score = 33.1 bits (72), Expect = 0.27 Identities = 17/57 (29%), Positives = 33/57 (57%) Frame = +3 Query: 99 PKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYDKSEWEEKAQKPKN 269 P++P + L++ +KIK +N G+ +I ++ G WR++ SE EE +K ++ Sbjct: 374 PRKPPRHFSLFMRENFAKIKAENQGMSNPDIMRELGAKWRNL-PFSEREEIRRKSED 429 >SB_27742| Best HMM Match : HMG_box (HMM E-Value=1.3e-24) Length = 201 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/46 (30%), Positives = 26/46 (56%) Frame = +3 Query: 102 KRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYDKSE 239 KRPM+A+++W + R K+ P + EI+K G W + ++ + Sbjct: 10 KRPMNAFMVWSRTERRKLALKYPNMLNCEISKLLGAEWSRLSEEEK 55 >SB_18120| Best HMM Match : Colipase_C (HMM E-Value=0.87) Length = 363 Score = 32.3 bits (70), Expect = 0.47 Identities = 13/31 (41%), Positives = 22/31 (70%) Frame = +1 Query: 310 RSRREKKENPKTREESETGAKNKESETGRRG 402 +SRREK+ NP+ R+++ G + K+S R+G Sbjct: 284 QSRREKRSNPEERDKAIPGRETKQSRGERQG 314 >SB_12387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1096 Score = 31.9 bits (69), Expect = 0.62 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +1 Query: 301 KWRRSRR-EKKENPKTREESETGAKNKESETGRRG 402 KW R E+++ PKT EE E ++N GRRG Sbjct: 236 KWLHDRYVEEEQAPKTAEELEESSRNLRRNAGRRG 270 >SB_35037| Best HMM Match : Far-17a_AIG1 (HMM E-Value=4.6e-30) Length = 227 Score = 31.5 bits (68), Expect = 0.82 Identities = 18/48 (37%), Positives = 25/48 (52%) Frame = -2 Query: 271 LFFGFCAFSSHSLLSYMDLQISPAFLAISVTFNPGLSSFIFDLALFNH 128 LF+G C H++ S DL+ P +L + PGL S I + LF H Sbjct: 98 LFWGLCIIDPHAIQSKEDLEQIPLWLNHYMHSFPGL-SVILETFLFKH 144 >SB_16481| Best HMM Match : HMG_box (HMM E-Value=1.2e-08) Length = 271 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/55 (29%), Positives = 26/55 (47%) Frame = +3 Query: 102 KRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYDKSEWEEKAQKPK 266 K PM+A+++ R NPG+ +E +K G W+ M E + +PK Sbjct: 10 KSPMNAFMVCSRGKRKHYASINPGMHNSEFSKSLGPEWK-MLTSEEKDPFIAEPK 63 >SB_18060| Best HMM Match : Pepsin-I3 (HMM E-Value=0.67) Length = 328 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/66 (27%), Positives = 32/66 (48%), Gaps = 1/66 (1%) Frame = +1 Query: 193 PKKQAKSGGPCMTKANGKKRRKSQ-RTIHCRFRII*CKWRRSRREKKENPKTREESETGA 369 PKK+ S + + +KRR + R + ++ +W R + EKKE + ++E Sbjct: 257 PKKKKPSNQQILRSSEVRKRRDDELRKLELAKQL---EWDRKQEEKKERKQKKKEERMRK 313 Query: 370 KNKESE 387 K +E E Sbjct: 314 KEQEKE 319 >SB_36647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +1 Query: 301 KWRRSRREKKENPKTREESETGAKNKESETGRRGR 405 K R+ +++KK+ K EE E +N+E E R+ R Sbjct: 15 KKRKKKKQKKQKKKKEEEEEEEEENEEEERRRKRR 49 Score = 29.5 bits (63), Expect = 3.3 Identities = 17/48 (35%), Positives = 27/48 (56%) Frame = +1 Query: 244 KKRRKSQRTIHCRFRII*CKWRRSRREKKENPKTREESETGAKNKESE 387 ++RR+ +R R R + R+ ++KKE + EE ET A N+E E Sbjct: 42 EERRRKRRRRRRRRR----RRRKKEKKKKEEEEEEEEEETEAVNEEEE 85 >SB_44844| Best HMM Match : DUF164 (HMM E-Value=0.094) Length = 332 Score = 28.7 bits (61), Expect = 5.8 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +3 Query: 153 IKDDNPGL-KVTEIAKKAGEIWRSMYDKSEWEEKAQK 260 IK D L K TE AKKA E W+ + + W+E+ ++ Sbjct: 232 IKKDLKKLPKTTEEAKKAEERWQRLKTELNWDERYEE 268 >SB_24670| Best HMM Match : DivIC (HMM E-Value=2) Length = 152 Score = 28.3 bits (60), Expect = 7.6 Identities = 14/48 (29%), Positives = 28/48 (58%) Frame = +3 Query: 117 AYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYDKSEWEEKAQK 260 AY +W ++ ++ K +K TE+A K ++ ++ + EWE+K +K Sbjct: 9 AYSVWQHAQQTLTKKREALVK-TELAGKNEKLPQAQEEVKEWEQKVEK 55 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,061,659 Number of Sequences: 59808 Number of extensions: 332453 Number of successful extensions: 1085 Number of sequences better than 10.0: 38 Number of HSP's better than 10.0 without gapping: 900 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1083 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2203769656 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -