BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30634.Seq (698 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14941| Best HMM Match : SH3_1 (HMM E-Value=1.1e-12) 29 3.6 SB_7939| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_17995| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_3575| Best HMM Match : DUF943 (HMM E-Value=4.5) 28 6.3 SB_28088| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 >SB_14941| Best HMM Match : SH3_1 (HMM E-Value=1.1e-12) Length = 469 Score = 29.1 bits (62), Expect = 3.6 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 3/47 (6%) Frame = +1 Query: 472 QYRFPNWIPFTTRNHPLELLL---SYAPIYIPYKSLECEIXAVAAGR 603 + +F NWIP+ PLELL SY P+ P E E + A R Sbjct: 407 EIQFENWIPYFCFVLPLELLQHYPSYRPVLTPATKPEEEPQQITAYR 453 >SB_7939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 289 Score = 28.7 bits (61), Expect = 4.8 Identities = 20/83 (24%), Positives = 37/83 (44%), Gaps = 3/83 (3%) Frame = +2 Query: 290 IHLPRGKKGXKSYKNNFKLV-WHPMRSSFAER--FDITNIACGYGFTVASIKTSEQHKVF 460 + LP K Y+ +F+L P + + +D T T+A ++T E H F Sbjct: 128 VRLPLPLKNDARYRGHFELCECSPHQGNIIASCSYDFTIKTWDTTSTLAPLETIEHHSEF 187 Query: 461 GTGINTDSQIGYHSPREIILWNF 529 TG++ H P ++ ++N+ Sbjct: 188 ATGLD----FNIHQPGQVSVFNY 206 >SB_17995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 653 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/50 (28%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +2 Query: 407 GYGFTVASIKTSEQHKVFGT-GINTDSQIGYHSPREIILWNFCLAMHLFI 553 GYG + + V G G+N + + H E++L + CLA +F+ Sbjct: 548 GYGLGIVQSARQFANLVAGLQGVNLEGMLLNHCKEELLLGDNCLARSIFV 597 >SB_3575| Best HMM Match : DUF943 (HMM E-Value=4.5) Length = 612 Score = 28.3 bits (60), Expect = 6.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 678 YRH*PYACYLMYRHLLCRSRNYC 610 YRH Y CY +R+ R +YC Sbjct: 17 YRHHHYCCYCHHRYCYYRHHHYC 39 >SB_28088| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 906 Score = 27.9 bits (59), Expect = 8.4 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -2 Query: 310 LATWEVDTQSTCLSKSPHMTRLS 242 + TW VD S C S SPH L+ Sbjct: 88 IRTWNVDVNSLCCSWSPHAVWLA 110 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,068,632 Number of Sequences: 59808 Number of extensions: 467236 Number of successful extensions: 1181 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1079 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1174 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -