BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30634.Seq (698 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g08710.1 68418.m01035 regulator of chromosome condensation (R... 31 0.56 At1g30930.1 68414.m03786 F-box family protein contains F-box dom... 31 0.97 At5g60870.2 68418.m07635 regulator of chromosome condensation (R... 29 2.2 At5g60870.1 68418.m07636 regulator of chromosome condensation (R... 29 2.2 At1g63740.1 68414.m07213 disease resistance protein (TIR-NBS-LRR... 29 3.0 At1g19880.1 68414.m02493 regulator of chromosome condensation (R... 29 3.0 At1g67720.1 68414.m07728 leucine-rich repeat family protein / pr... 28 6.8 At1g22710.1 68414.m02838 sucrose transporter / sucrose-proton sy... 28 6.8 At1g33080.2 68414.m04081 MATE efflux family protein similar to r... 27 9.0 At1g33080.1 68414.m04082 MATE efflux family protein similar to r... 27 9.0 >At5g08710.1 68418.m01035 regulator of chromosome condensation (RCC1) family protein / UVB-resistance protein-related contains Pfam PF00415 : Regulator of chromosome condensation (RCC1); similar to UVB-resistance protein UVR8 (GI:10177674) {Arabidopsis thaliana} Length = 434 Score = 31.5 bits (68), Expect = 0.56 Identities = 18/53 (33%), Positives = 24/53 (45%) Frame = +2 Query: 335 NFKLVWHPMRSSFAERFDITNIACGYGFTVASIKTSEQHKVFGTGINTDSQIG 493 N W P S IT +ACG T+ +E +VF TG+N Q+G Sbjct: 66 NLDSQWTPAVCSALSDHSITAVACGGAHTLF---LTETRRVFATGLNDCGQLG 115 >At1g30930.1 68414.m03786 F-box family protein contains F-box domain Pfam:PF00646 Length = 376 Score = 30.7 bits (66), Expect = 0.97 Identities = 17/63 (26%), Positives = 31/63 (49%), Gaps = 7/63 (11%) Frame = -3 Query: 624 SRNYCVSTSRCHCXNLTLQALVR-------YINRCIAKQKFQRMISRGEWYPIWESVLIP 466 SR+ S +RCHC + +A+ R ++ R A+ + ++ GEW W + +P Sbjct: 15 SRSTAKSVARCHCVSKQWRAIFRRKYFIELFLTRSKARPRILFVVQDGEWSE-WSFLSLP 73 Query: 465 VPK 457 P+ Sbjct: 74 QPQ 76 >At5g60870.2 68418.m07635 regulator of chromosome condensation (RCC1) family protein weak similarity to UVB-resistance protein UVR8 [Arabidopsis thaliana] GI:5478530; contains Pfam profile PF00415: Regulator of chromosome condensation (RCC1) Length = 383 Score = 29.5 bits (63), Expect = 2.2 Identities = 20/53 (37%), Positives = 25/53 (47%) Frame = +2 Query: 350 WHPMRSSFAERFDITNIACGYGFTVASIKTSEQHKVFGTGINTDSQIGYHSPR 508 W PM E IT IACG G+ S+ +E+ KV G Q+G S R Sbjct: 234 WEPMPVPSLEGVRITQIACG-GY--HSLALTEEGKVLSWGHGGHGQLGSSSLR 283 >At5g60870.1 68418.m07636 regulator of chromosome condensation (RCC1) family protein weak similarity to UVB-resistance protein UVR8 [Arabidopsis thaliana] GI:5478530; contains Pfam profile PF00415: Regulator of chromosome condensation (RCC1) Length = 445 Score = 29.5 bits (63), Expect = 2.2 Identities = 20/53 (37%), Positives = 25/53 (47%) Frame = +2 Query: 350 WHPMRSSFAERFDITNIACGYGFTVASIKTSEQHKVFGTGINTDSQIGYHSPR 508 W PM E IT IACG G+ S+ +E+ KV G Q+G S R Sbjct: 303 WEPMPVPSLEGVRITQIACG-GY--HSLALTEEGKVLSWGHGGHGQLGSSSLR 352 >At1g63740.1 68414.m07213 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 992 Score = 29.1 bits (62), Expect = 3.0 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +2 Query: 440 SEQHKVFGTGINTDSQIGYHSPREIILWNFCLAMHLFI 553 SEQ + G ++D ++ +H + + W FC H F+ Sbjct: 950 SEQVSEYEDGYHSDRRLEFHEQKSLPGWGFCGIFHGFL 987 >At1g19880.1 68414.m02493 regulator of chromosome condensation (RCC1) family protein low similarity to UVB-resistance protein UVR8 [Arabidopsis thaliana] GI:5478530; contains Pfam profile PF00415: Regulator of chromosome condensation (RCC1) Length = 538 Score = 29.1 bits (62), Expect = 3.0 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = +2 Query: 386 DITNIACGYGFTVASIKTSEQHKVFGTGINTDSQIGYHSPRE 511 ++TN+ACG FTV + ++E + G+ Q+G+ + E Sbjct: 168 EVTNVACGADFTV-WLSSTEGASILTAGLPQYGQLGHGTDNE 208 >At1g67720.1 68414.m07728 leucine-rich repeat family protein / protein kinase family protein contains similarity to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains Pfam doamins PF00069: Protein kinase domain and PF00560: Leucine Rich Repeat Length = 929 Score = 27.9 bits (59), Expect = 6.8 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 285 WVSTSHVARKGXKVTKTTSNWFGIQ 359 WVS S + ++G VT +NW +Q Sbjct: 46 WVSDSEIIKQGKPVTLANTNWNSMQ 70 >At1g22710.1 68414.m02838 sucrose transporter / sucrose-proton symporter (SUC2) nearly identical to sucrose-proton symporter SUC2 [Arabidopsis thaliana] GI:407092 Length = 512 Score = 27.9 bits (59), Expect = 6.8 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = -3 Query: 615 YCVSTSRCHCXNLTLQALVRYINRCIAKQK 526 YC + C ++TL +V +++ C K+K Sbjct: 218 YCANLKTCFFLSITLLLIVTFVSLCYVKEK 247 >At1g33080.2 68414.m04081 MATE efflux family protein similar to ripening regulated protein DDTFR18 [Lycopersicon esculentum] GI:12231296; contains Pfam profile PF01554: Uncharacterized membrane protein family Length = 490 Score = 27.5 bits (58), Expect = 9.0 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -2 Query: 361 HWMPNQFEVVFVTFXPFLATW 299 HW+PN +V+FVT TW Sbjct: 226 HWLPNIAQVLFVTCGGCTETW 246 >At1g33080.1 68414.m04082 MATE efflux family protein similar to ripening regulated protein DDTFR18 [Lycopersicon esculentum] GI:12231296; contains Pfam profile PF01554: Uncharacterized membrane protein family Length = 494 Score = 27.5 bits (58), Expect = 9.0 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -2 Query: 361 HWMPNQFEVVFVTFXPFLATW 299 HW+PN +V+FVT TW Sbjct: 226 HWLPNIAQVLFVTCGGCTETW 246 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,505,300 Number of Sequences: 28952 Number of extensions: 325551 Number of successful extensions: 773 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 757 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 772 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -