BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30633.Seq (698 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g19490.2 68417.m02867 expressed protein 29 3.0 At4g19490.1 68417.m02866 expressed protein 29 3.0 At1g62020.1 68414.m06995 coatomer protein complex, subunit alpha... 29 3.9 At1g02140.1 68414.m00140 mago nashi family protein similar to Ma... 28 5.2 At2g39910.1 68415.m04905 expressed protein 28 6.8 At1g08400.1 68414.m00929 chromosome structural maintenance prote... 25 7.3 >At4g19490.2 68417.m02867 expressed protein Length = 1054 Score = 29.1 bits (62), Expect = 3.0 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 2/44 (4%) Frame = +2 Query: 236 EFAF--TREVIELTRIIDQSSSTKDLQTIFPQLINNIFSSSFST 361 EFA+ TREV L R++ ++ D+Q IF Q+I+ I + + T Sbjct: 949 EFAWPLTREVGYLHRVLSETLHEADVQAIFRQVISIIHTQTSQT 992 >At4g19490.1 68417.m02866 expressed protein Length = 1054 Score = 29.1 bits (62), Expect = 3.0 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 2/44 (4%) Frame = +2 Query: 236 EFAF--TREVIELTRIIDQSSSTKDLQTIFPQLINNIFSSSFST 361 EFA+ TREV L R++ ++ D+Q IF Q+I+ I + + T Sbjct: 949 EFAWPLTREVGYLHRVLSETLHEADVQAIFRQVISIIHTQTSQT 992 >At1g62020.1 68414.m06995 coatomer protein complex, subunit alpha, putative contains Pfam PF00400: WD domain, G-beta repeat; similar to Coatomer alpha subunit (Alpha-coat protein) (Alpha-COP) (HEPCOP) (HEP-COP) (SP:P53621) [Homo sapiens] Length = 1216 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -1 Query: 560 NCGHLPLSNVTCRSRGNNLMAIRTSTE 480 N GHLPL+ +T G N +A R +TE Sbjct: 753 NAGHLPLAYITASVHGLNDIAERLATE 779 >At1g02140.1 68414.m00140 mago nashi family protein similar to Mago Nashi, Genbank Accession Number U03559; contains Pfam PF02792: Mago nashi protein domain Length = 150 Score = 28.3 bits (60), Expect = 5.2 Identities = 15/63 (23%), Positives = 31/63 (49%) Frame = +2 Query: 137 YENKSLEYIFNHQTKLNK*NNGSRFDESVLYKSEFAFTREVIELTRIIDQSSSTKDLQTI 316 + ++ LE+ F KL NN + +++++ K F + E RI+ +S K+ Sbjct: 21 FGHEFLEFEFREDGKLRYANNSNYKNDTIIRKEVFLTPAVLKECKRIVSESEILKEDDNN 80 Query: 317 FPQ 325 +P+ Sbjct: 81 WPE 83 >At2g39910.1 68415.m04905 expressed protein Length = 436 Score = 27.9 bits (59), Expect = 6.8 Identities = 13/56 (23%), Positives = 27/56 (48%) Frame = +2 Query: 233 SEFAFTREVIELTRIIDQSSSTKDLQTIFPQLINNIFSSSFSTGWDLKSITCDVNR 400 S+F+ +L +++ S + L + P+L + I SS G D + ++ + R Sbjct: 117 SDFSSNSNAEKLVELVEDSEKIEMLPIVLPELKDGIEKSSLGKGSDAEDVSAAMAR 172 >At1g08400.1 68414.m00929 chromosome structural maintenance protein-related contains weak similarity to RAD50-interacting protein 1 [Homo sapiens] gi|11967435|gb|AAG42101 Length = 804 Score = 24.6 bits (51), Expect(2) = 7.3 Identities = 17/59 (28%), Positives = 26/59 (44%), Gaps = 2/59 (3%) Frame = +2 Query: 248 TREVIELTRIIDQSSST--KDLQTIFPQLINNIFSSSFSTGWDLKSITCDVNRYEFEAL 418 TR R++D S K L + PQ+I + + S GW K T V E +++ Sbjct: 185 TRHHSRWRRLVDSVDSRVDKSLSVLRPQIIADHRAFLSSLGWPPKLATSKVEHGEVDSI 243 Score = 21.4 bits (43), Expect(2) = 7.3 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +2 Query: 515 LLIYR*H*KEGDAHNFMLTC*LQMH 589 LL+ + KE + +F+L C LQ H Sbjct: 247 LLLMQGDKKESYSQSFLLLCGLQQH 271 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,863,881 Number of Sequences: 28952 Number of extensions: 270332 Number of successful extensions: 512 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 505 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 512 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -