BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30632.Seq (459 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z82077-3|CAB63331.1| 122|Caenorhabditis elegans Hypothetical pr... 97 4e-21 Z82077-4|CAB63332.1| 70|Caenorhabditis elegans Hypothetical pr... 64 5e-11 >Z82077-3|CAB63331.1| 122|Caenorhabditis elegans Hypothetical protein W09C5.6a protein. Length = 122 Score = 97.5 bits (232), Expect = 4e-21 Identities = 43/64 (67%), Positives = 54/64 (84%) Frame = +2 Query: 62 PKGERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDT 241 PK E+K +S INEVVTREYT+++H R+ G+G KKRAPRAI EI+KFA+ QM T D+RVDT Sbjct: 3 PKNEKKSRSTINEVVTREYTIHIHARIRGIGSKKRAPRAIDEIKKFAKIQMKTNDVRVDT 62 Query: 242 RLNK 253 +LNK Sbjct: 63 KLNK 66 Score = 64.1 bits (149), Expect = 5e-11 Identities = 27/59 (45%), Positives = 37/59 (62%) Frame = +1 Query: 244 LKQILWSKGVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTENVDASQ 420 L + +WSKG++NVP+ N+DEDSA KL+TL TYVP + GL NVD+ + Sbjct: 64 LNKFIWSKGIKNVPYRVRVRLSRRRNEDEDSAQKLYTLCTYVPCTNFHGLTNVNVDSEE 122 >Z82077-4|CAB63332.1| 70|Caenorhabditis elegans Hypothetical protein W09C5.6b protein. Length = 70 Score = 64.1 bits (149), Expect = 5e-11 Identities = 27/59 (45%), Positives = 37/59 (62%) Frame = +1 Query: 244 LKQILWSKGVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTENVDASQ 420 L + +WSKG++NVP+ N+DEDSA KL+TL TYVP + GL NVD+ + Sbjct: 12 LNKFIWSKGIKNVPYRVRVRLSRRRNEDEDSAQKLYTLCTYVPCTNFHGLTNVNVDSEE 70 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,573,372 Number of Sequences: 27780 Number of extensions: 181663 Number of successful extensions: 408 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 394 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 408 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 820565746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -