BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30631.Seq (409 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g26230.1 68417.m03776 60S ribosomal protein L31 (RPL31B) ribo... 109 5e-25 At5g56710.1 68418.m07078 60S ribosomal protein L31 (RPL31C) 107 3e-24 At2g19740.1 68415.m02306 60S ribosomal protein L31 (RPL31A) 106 5e-24 At4g17250.1 68417.m02594 expressed protein 28 2.1 At3g19400.2 68416.m02460 cysteine proteinase, putative non-conse... 28 2.1 At3g19400.1 68416.m02461 cysteine proteinase, putative non-conse... 28 2.1 At3g51220.1 68416.m05607 expressed protein contains Pfam doamin ... 27 3.7 At1g32900.1 68414.m04053 starch synthase, putative similar to st... 27 4.8 At3g43960.1 68416.m04706 cysteine proteinase, putative contains ... 26 8.5 >At4g26230.1 68417.m03776 60S ribosomal protein L31 (RPL31B) ribosomal protein L31, Nicotiana glutinosa, U23784 Length = 119 Score = 109 bits (263), Expect = 5e-25 Identities = 49/72 (68%), Positives = 60/72 (83%) Frame = +3 Query: 42 ERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLN 221 E+KG+ EVVTREYT+NLH+RLH FKK+AP+AIKEIRKFAEK+MGT D+RVD +LN Sbjct: 3 EKKGRK--EEVVTREYTINLHRRLHSCTFKKKAPKAIKEIRKFAEKEMGTKDVRVDVKLN 60 Query: 222 KFLWSKGVRNVP 257 K +WSKG+R P Sbjct: 61 KQIWSKGIRGPP 72 Score = 26.6 bits (56), Expect = 6.4 Identities = 12/32 (37%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = +2 Query: 293 DDEDSAHKXFTLVTY--VPVASIKGLQTENVD 382 DDED+ + F+LVT +P + GL T+ ++ Sbjct: 85 DDEDAKEEFFSLVTVAEIPAEGLSGLGTKIIE 116 >At5g56710.1 68418.m07078 60S ribosomal protein L31 (RPL31C) Length = 119 Score = 107 bits (257), Expect = 3e-24 Identities = 48/72 (66%), Positives = 59/72 (81%) Frame = +3 Query: 42 ERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLN 221 E+KG+ EV+TREYT+NLH+RLH FKK+AP+AIKEIRKFAEK MGT D+RVD +LN Sbjct: 3 EKKGRK--EEVITREYTINLHRRLHKCTFKKKAPKAIKEIRKFAEKAMGTKDVRVDVKLN 60 Query: 222 KFLWSKGVRNVP 257 K +WSKG+R P Sbjct: 61 KQIWSKGIRGPP 72 Score = 26.6 bits (56), Expect = 6.4 Identities = 12/32 (37%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = +2 Query: 293 DDEDSAHKXFTLVTY--VPVASIKGLQTENVD 382 DDED+ + F+LVT +P + GL T+ ++ Sbjct: 85 DDEDAKEEFFSLVTVAEIPAEGLSGLGTKVIE 116 >At2g19740.1 68415.m02306 60S ribosomal protein L31 (RPL31A) Length = 119 Score = 106 bits (255), Expect = 5e-24 Identities = 48/70 (68%), Positives = 55/70 (78%) Frame = +3 Query: 48 KGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKF 227 KGK EVVTREYT+NLH+RLH FKK+AP AIKEIRKFA K MGT D+RVD +LNK Sbjct: 3 KGKGRKEEVVTREYTINLHRRLHSCTFKKKAPNAIKEIRKFALKAMGTKDVRVDVKLNKQ 62 Query: 228 LWSKGVRNVP 257 +WSKG+R P Sbjct: 63 IWSKGIRGPP 72 Score = 27.1 bits (57), Expect = 4.8 Identities = 12/35 (34%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = +2 Query: 293 DDEDSAHKXFTLVTY--VPVASIKGLQTENVDASQ 391 DDED+ + F+LVT +P + GL T+ ++ + Sbjct: 85 DDEDAKEEFFSLVTVAEIPAEGLSGLGTKVIEEEE 119 >At4g17250.1 68417.m02594 expressed protein Length = 416 Score = 28.3 bits (60), Expect = 2.1 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +3 Query: 90 TVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVD 209 TV KR + +KKR A+K+ + E++ G P ++ D Sbjct: 169 TVPATKRFLELKYKKRYEFALKQCPSYTERRRGVPKLKED 208 >At3g19400.2 68416.m02460 cysteine proteinase, putative non-consensus AT acceptor site at exon 3; contains similarity to cysteine protease CYP1 GI:2828252, TDI-65 GI:5726641 from [Lycopersicon esculentum] Length = 290 Score = 28.3 bits (60), Expect = 2.1 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = +3 Query: 84 EYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKF 227 ++ V K +G+G K+R + K+ KF ++ PD + L +F Sbjct: 46 QWLVENRKNYNGLGEKERRFKIFKDNLKFVDEHNSVPDRTFEVGLTRF 93 >At3g19400.1 68416.m02461 cysteine proteinase, putative non-consensus AT acceptor site at exon 3; contains similarity to cysteine protease CYP1 GI:2828252, TDI-65 GI:5726641 from [Lycopersicon esculentum] Length = 362 Score = 28.3 bits (60), Expect = 2.1 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = +3 Query: 84 EYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKF 227 ++ V K +G+G K+R + K+ KF ++ PD + L +F Sbjct: 46 QWLVENRKNYNGLGEKERRFKIFKDNLKFVDEHNSVPDRTFEVGLTRF 93 >At3g51220.1 68416.m05607 expressed protein contains Pfam doamin PF05701: Plant protein of unknown function (DUF827) Length = 186 Score = 27.5 bits (58), Expect = 3.7 Identities = 16/71 (22%), Positives = 31/71 (43%) Frame = +3 Query: 15 KITMAKPKGERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTP 194 K + K + E K S + E +T+E K H + P+ +++ E + P Sbjct: 53 KENLKKAEEENKVLSQLIESLTQELETTKEKLNHSLRNFPEHPQVEDDLKFIEESTVNEP 112 Query: 195 DIRVDTRLNKF 227 D + ++N+F Sbjct: 113 DNITEIKMNRF 123 >At1g32900.1 68414.m04053 starch synthase, putative similar to starch synthase SP:Q42857 from [Ipomoea batatas] Length = 610 Score = 27.1 bits (57), Expect = 4.8 Identities = 14/55 (25%), Positives = 26/55 (47%) Frame = +3 Query: 42 ERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRV 206 E+KG + E +++ +N+ + G G KK + ++ KF K +G V Sbjct: 412 EQKGSDILVEAISKFMGLNVQMVILGTGKKKMEAQILELEEKFPGKAVGVAKFNV 466 >At3g43960.1 68416.m04706 cysteine proteinase, putative contains similarity to cysteine proteinase RD21A (thiol protease) GI:435619, SP:P43297 from [Arabidopsis thaliana] Length = 376 Score = 26.2 bits (55), Expect = 8.5 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Frame = +3 Query: 69 EVVT--REYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKF 227 EV+T ++ V K +G+G K+R + K+ K E+ P+ + LNKF Sbjct: 36 EVLTMYEQWLVENGKNYNGLGEKERRFKIFKDNLKRIEEHNSDPNRSYERGLNKF 90 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,106,950 Number of Sequences: 28952 Number of extensions: 140744 Number of successful extensions: 308 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 300 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 308 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 605614832 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -