BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30627.Seq (459 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase... 25 1.7 U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase... 24 2.2 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 22 9.0 AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. 22 9.0 AF515525-1|AAM61892.1| 235|Anopheles gambiae glutathione S-tran... 22 9.0 >U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase protein. Length = 332 Score = 24.6 bits (51), Expect = 1.7 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +2 Query: 134 KRLHGVGFKKRAPRAIKEIR 193 +RLH GF R PR +++++ Sbjct: 96 RRLHAAGFCARRPRKVRKLQ 115 >U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase protein. Length = 260 Score = 24.2 bits (50), Expect = 2.2 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +2 Query: 134 KRLHGVGFKKRAPRAIKEI 190 +RLH GF R PR ++++ Sbjct: 24 RRLHAAGFCARRPRKVRKL 42 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 22.2 bits (45), Expect = 9.0 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -3 Query: 334 NLHHHYVFVKASHGH 290 N+H H +F HGH Sbjct: 425 NIHLHALFSAVEHGH 439 >AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. Length = 897 Score = 22.2 bits (45), Expect = 9.0 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = -1 Query: 267 LRPKDLFKRVSTRMSGVP-ICFSANFRISLIALGARFLNP 151 +RPKD+ KR+ + G + + R L L LNP Sbjct: 511 MRPKDMRKRLMVKFKGEEGLDYGGVAREWLYLLSHEMLNP 550 >AF515525-1|AAM61892.1| 235|Anopheles gambiae glutathione S-transferase protein. Length = 235 Score = 22.2 bits (45), Expect = 9.0 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 101 LRLWLICLFFHLWV*PLL 48 LR + FFH+W+ PLL Sbjct: 109 LRADVSLYFFHVWLNPLL 126 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 436,846 Number of Sequences: 2352 Number of extensions: 8415 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 39544623 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -