BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30626.Seq (587 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein... 25 1.8 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 23 9.7 AY341205-1|AAR13769.1| 285|Anopheles gambiae period protein. 23 9.7 AY341204-1|AAR13768.1| 285|Anopheles gambiae period protein. 23 9.7 AY341203-1|AAR13767.1| 285|Anopheles gambiae period protein. 23 9.7 AY341202-1|AAR13766.1| 285|Anopheles gambiae period protein. 23 9.7 >AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein coupled receptor protein. Length = 459 Score = 25.0 bits (52), Expect = 1.8 Identities = 17/38 (44%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +2 Query: 245 SQGCGHVAQVYAIRQAISKALIAFYQKYV-DEASKKEI 355 S GC VA V A+ + I+ A FY KYV D+ +K I Sbjct: 145 SSGC--VAFVMALERYIALAKPFFYHKYVTDKLIRKSI 180 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 22.6 bits (46), Expect = 9.7 Identities = 7/17 (41%), Positives = 8/17 (47%) Frame = -3 Query: 540 HHPMISQ*QHEPRRYHP 490 HHP + H P Y P Sbjct: 134 HHPSVHHPAHHPLHYQP 150 >AY341205-1|AAR13769.1| 285|Anopheles gambiae period protein. Length = 285 Score = 22.6 bits (46), Expect = 9.7 Identities = 10/29 (34%), Positives = 20/29 (68%), Gaps = 3/29 (10%) Frame = +2 Query: 281 IRQAISK---ALIAFYQKYVDEASKKEIK 358 ++Q +SK AL +F ++ +DE ++ E+K Sbjct: 95 VKQEVSKRCKALASFMEELMDEVAQPELK 123 >AY341204-1|AAR13768.1| 285|Anopheles gambiae period protein. Length = 285 Score = 22.6 bits (46), Expect = 9.7 Identities = 10/29 (34%), Positives = 20/29 (68%), Gaps = 3/29 (10%) Frame = +2 Query: 281 IRQAISK---ALIAFYQKYVDEASKKEIK 358 ++Q +SK AL +F ++ +DE ++ E+K Sbjct: 95 VKQEVSKRCKALASFMEELMDEVAQPELK 123 >AY341203-1|AAR13767.1| 285|Anopheles gambiae period protein. Length = 285 Score = 22.6 bits (46), Expect = 9.7 Identities = 10/29 (34%), Positives = 20/29 (68%), Gaps = 3/29 (10%) Frame = +2 Query: 281 IRQAISK---ALIAFYQKYVDEASKKEIK 358 ++Q +SK AL +F ++ +DE ++ E+K Sbjct: 95 VKQEVSKRCKALASFMEELMDEVAQPELK 123 >AY341202-1|AAR13766.1| 285|Anopheles gambiae period protein. Length = 285 Score = 22.6 bits (46), Expect = 9.7 Identities = 10/29 (34%), Positives = 20/29 (68%), Gaps = 3/29 (10%) Frame = +2 Query: 281 IRQAISK---ALIAFYQKYVDEASKKEIK 358 ++Q +SK AL +F ++ +DE ++ E+K Sbjct: 95 VKQEVSKRCKALASFMEELMDEVAQPELK 123 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 641,155 Number of Sequences: 2352 Number of extensions: 12688 Number of successful extensions: 29 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 56347938 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -