BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30606.Seq (698 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 5e-15 SB_35685| Best HMM Match : Ribosomal_S8 (HMM E-Value=0.08) 76 3e-14 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 5e-11 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 58 5e-09 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 57 1e-08 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 56 2e-08 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 56 3e-08 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 56 3e-08 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 56 3e-08 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_58985| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 8e-08 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_24747| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_51749| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_51748| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_26800| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_9428| Best HMM Match : Vicilin_N (HMM E-Value=4.2) 52 4e-07 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 51 8e-07 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 50 2e-06 SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 50 2e-06 SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 50 2e-06 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 50 2e-06 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 49 3e-06 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 49 3e-06 SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) 49 3e-06 SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 49 4e-06 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_7086| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 48 6e-06 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 48 6e-06 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 48 6e-06 SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 48 6e-06 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 48 6e-06 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 48 7e-06 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 48 7e-06 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 48 7e-06 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 48 7e-06 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 48 7e-06 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 48 7e-06 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 48 7e-06 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 48 7e-06 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 48 7e-06 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 48 7e-06 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 48 7e-06 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 48 7e-06 SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) 48 7e-06 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 48 7e-06 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 48 7e-06 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 48 7e-06 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 48 7e-06 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 48 7e-06 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 48 7e-06 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 48 7e-06 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 48 7e-06 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 48 7e-06 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 48 7e-06 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 48 7e-06 SB_22375| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 48 7e-06 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 48 7e-06 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 48 7e-06 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 48 7e-06 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 48 7e-06 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 48 7e-06 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 48 7e-06 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 48 7e-06 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 48 7e-06 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 48 7e-06 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 48 7e-06 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 48 7e-06 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 48 7e-06 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 48 7e-06 SB_51352| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 48 7e-06 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) 48 7e-06 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 48 7e-06 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_44512| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 48 7e-06 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 48 7e-06 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_31079| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_28860| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_20651| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 48 7e-06 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_16729| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_16672| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 48 7e-06 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 48 7e-06 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 48 7e-06 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 48 7e-06 SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_969| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_52731| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 48 1e-05 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 48 1e-05 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_9479| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 48 1e-05 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 48 1e-05 SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) 48 1e-05 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 47 1e-05 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 47 1e-05 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 47 1e-05 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 47 1e-05 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 47 1e-05 SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 47 1e-05 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 47 1e-05 SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 47 1e-05 SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) 47 1e-05 SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) 47 1e-05 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 47 1e-05 SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 47 1e-05 SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) 47 1e-05 SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 47 1e-05 SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) 47 1e-05 SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 47 1e-05 SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) 47 1e-05 SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) 47 1e-05 SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 47 1e-05 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 47 1e-05 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) 47 1e-05 SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 47 1e-05 SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) 47 1e-05 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) 47 1e-05 SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 47 1e-05 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 47 1e-05 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 47 1e-05 SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) 47 1e-05 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 47 1e-05 SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) 47 1e-05 SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) 47 1e-05 SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) 47 1e-05 SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 47 1e-05 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 47 1e-05 SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 47 1e-05 SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 47 1e-05 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) 47 1e-05 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 47 1e-05 SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 47 1e-05 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 47 1e-05 SB_55182| Best HMM Match : T4_deiodinase (HMM E-Value=0) 47 1e-05 SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) 47 1e-05 SB_54335| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 47 1e-05 SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 47 1e-05 SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) 47 1e-05 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 47 1e-05 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_49046| Best HMM Match : BA14K (HMM E-Value=6.4) 47 1e-05 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 47 1e-05 SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 47 1e-05 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 47 1e-05 SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 47 1e-05 SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 47 1e-05 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 78.6 bits (185), Expect = 5e-15 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = -1 Query: 695 ATVGKGDRCGPSSLLRQLAERGMCCKAIKLGNAQGFPSHDVVKRRP 558 ATVGKGDRCG ++ ERGMCCKAIKLGNA+GFPSHDVVKRRP Sbjct: 3 ATVGKGDRCGLFAIT-PAGERGMCCKAIKLGNAKGFPSHDVVKRRP 47 Score = 39.1 bits (87), Expect = 0.003 Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = -2 Query: 652 YASWPKG--GCAARRLSWVTPRVFPVTTL*NDGPVNCNTTHYRANW 521 +A P G G + + + FP + PVNCNTTHYRANW Sbjct: 14 FAITPAGERGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 >SB_35685| Best HMM Match : Ribosomal_S8 (HMM E-Value=0.08) Length = 120 Score = 75.8 bits (178), Expect = 3e-14 Identities = 38/44 (86%), Positives = 40/44 (90%) Frame = -3 Query: 465 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMKH 334 MVR+NVL+DAL SI NAEKRGKRQV IRP SKVIVKFLTVMMKH Sbjct: 1 MVRVNVLNDALVSICNAEKRGKRQVQIRPSSKVIVKFLTVMMKH 44 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 65.3 bits (152), Expect = 5e-11 Identities = 33/55 (60%), Positives = 37/55 (67%) Frame = -2 Query: 685 GRAIGAGPLRYYASWPKGGCAARRLSWVTPRVFPVTTL*NDGPVNCNTTHYRANW 521 GR++ A L + KGGCAARRLSWVTP FP + PVNCNTTHYRANW Sbjct: 29 GRSVRASSLLRQLA--KGGCAARRLSWVTPG-FPSHDVVKRRPVNCNTTHYRANW 80 Score = 29.9 bits (64), Expect = 2.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -3 Query: 696 RNCWEGRSVRA 664 RNCWEGRSVRA Sbjct: 24 RNCWEGRSVRA 34 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 63.3 bits (147), Expect = 2e-10 Identities = 33/58 (56%), Positives = 38/58 (65%) Frame = +2 Query: 524 IRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 IRPIVSRITIHW +RRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 18 IRPIVSRITIHWPSFYKRRDWENPGVNQLNRLAAHPPF-ASWRSSEEARTDRPSQQLR 74 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 60.1 bits (139), Expect = 2e-09 Identities = 32/59 (54%), Positives = 37/59 (62%) Frame = -2 Query: 697 AQLLGRAIGAGPLRYYASWPKGGCAARRLSWVTPRVFPVTTL*NDGPVNCNTTHYRANW 521 AQLLGRAIGAG + +G C + + VTP VFP + PVNCNTTHYRANW Sbjct: 1843 AQLLGRAIGAGLFAITPAGERGMCC-KAIKLVTP-VFPSHDVVKRRPVNCNTTHYRANW 1899 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 59.7 bits (138), Expect = 2e-09 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +3 Query: 561 PSFYNVVTGKTLGVTQLNRLAAHPPF 638 PSFYNVVTGKTLGVTQLNRLAAHPPF Sbjct: 7 PSFYNVVTGKTLGVTQLNRLAAHPPF 32 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 59.3 bits (137), Expect = 3e-09 Identities = 31/54 (57%), Positives = 36/54 (66%) Frame = +2 Query: 536 VSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 +SRITIHW VLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 277 LSRITIHWPSVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 329 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 58.4 bits (135), Expect = 5e-09 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -1 Query: 638 ERGMCCKAIKLGNAQGFPSHDVVKRRP 558 ERGMCCKAIKLGNA FPSHDVVKRRP Sbjct: 15 ERGMCCKAIKLGNASVFPSHDVVKRRP 41 Score = 44.8 bits (101), Expect = 7e-05 Identities = 23/53 (43%), Positives = 28/53 (52%) Frame = -2 Query: 679 AIGAGPLRYYASWPKGGCAARRLSWVTPRVFPVTTL*NDGPVNCNTTHYRANW 521 AIGAG + +G C + + VFP + PVNCNTTHYRANW Sbjct: 2 AIGAGLFAITPAGERGMCC-KAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 53 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 58.4 bits (135), Expect = 5e-09 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -1 Query: 638 ERGMCCKAIKLGNAQGFPSHDVVKRRP 558 ERGMCCKAIKLGNA FPSHDVVKRRP Sbjct: 29 ERGMCCKAIKLGNASVFPSHDVVKRRP 55 Score = 56.0 bits (129), Expect = 3e-08 Identities = 29/59 (49%), Positives = 34/59 (57%) Frame = -2 Query: 697 AQLLGRAIGAGPLRYYASWPKGGCAARRLSWVTPRVFPVTTL*NDGPVNCNTTHYRANW 521 AQLLGRAIGAG + +G C + + VFP + PVNCNTTHYRANW Sbjct: 10 AQLLGRAIGAGLFAITPAGERGMCC-KAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 67 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 58.0 bits (134), Expect = 7e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -1 Query: 644 LAERGMCCKAIKLGNAQGFPSHDVVKRRP 558 LAERGMCCKAIKLGNA F SHDVVKRRP Sbjct: 1 LAERGMCCKAIKLGNASVFRSHDVVKRRP 29 Score = 33.1 bits (72), Expect = 0.22 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 559 PVNCNTTHYRAN 524 PVNCNTTHYRAN Sbjct: 29 PVNCNTTHYRAN 40 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = -1 Query: 638 ERGMCCKAIKLGNAQGFPSHDVVKRRP 558 ERGMCCKAIKLGNA+GFPSHD KRRP Sbjct: 60 ERGMCCKAIKLGNARGFPSHDGEKRRP 86 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/58 (46%), Positives = 32/58 (55%) Frame = -2 Query: 697 AQLLGRAIGAGPLRYYASWPKGGCAARRLSWVTPRVFPVTTL*NDGPVNCNTTHYRAN 524 AQLLGR+IGAG + +G C + + R FP PVNCNTTHYRAN Sbjct: 41 AQLLGRSIGAGLFAITPAGERGMCC-KAIKLGNARGFPSHDGEKRRPVNCNTTHYRAN 97 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 561 PSFYNVVTGKTLGVTQLNRLAAHPPF 638 PSFYNVVTGKTL VTQLNRLAAHPPF Sbjct: 9 PSFYNVVTGKTLSVTQLNRLAAHPPF 34 Score = 27.9 bits (59), Expect = 8.4 Identities = 20/53 (37%), Positives = 25/53 (47%) Frame = +2 Query: 539 SRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 SRITIHW + + PF + ++ ARTDRPSQQLR Sbjct: 2 SRITIHWPSFYNVVTGKTLSVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLR 53 >SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 57.2 bits (132), Expect = 1e-08 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = -2 Query: 667 GPLRYYASWPKGGCAARRLSWVTP 596 GPLRYYASW KGGCAARRLSWVTP Sbjct: 72 GPLRYYASWRKGGCAARRLSWVTP 95 Score = 32.3 bits (70), Expect = 0.39 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 597 PGFSQSRRCKTTA 559 PGFSQSRRCKTTA Sbjct: 95 PGFSQSRRCKTTA 107 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 56.4 bits (130), Expect = 2e-08 Identities = 29/59 (49%), Positives = 34/59 (57%) Frame = -2 Query: 697 AQLLGRAIGAGPLRYYASWPKGGCAARRLSWVTPRVFPVTTL*NDGPVNCNTTHYRANW 521 AQLLGRAIGAG + +G C + + VFP + PVNCNTTHYRANW Sbjct: 4 AQLLGRAIGAGLFAITPAGERGMCC-KSIKLAHASVFPSHDVVKRRPVNCNTTHYRANW 61 Score = 52.8 bits (121), Expect = 3e-07 Identities = 22/27 (81%), Positives = 24/27 (88%) Frame = -1 Query: 638 ERGMCCKAIKLGNAQGFPSHDVVKRRP 558 ERGMCCK+IKL +A FPSHDVVKRRP Sbjct: 23 ERGMCCKSIKLAHASVFPSHDVVKRRP 49 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 56.0 bits (129), Expect = 3e-08 Identities = 30/55 (54%), Positives = 34/55 (61%) Frame = -2 Query: 685 GRAIGAGPLRYYASWPKGGCAARRLSWVTPRVFPVTTL*NDGPVNCNTTHYRANW 521 GR++ A L + KGGCAARRLSW FP + PVNCNTTHYRANW Sbjct: 600 GRSVRASSLLRQLA--KGGCAARRLSWG----FPSHDVVKRRPVNCNTTHYRANW 648 Score = 29.9 bits (64), Expect = 2.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -3 Query: 696 RNCWEGRSVRA 664 RNCWEGRSVRA Sbjct: 595 RNCWEGRSVRA 605 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 56.0 bits (129), Expect = 3e-08 Identities = 30/55 (54%), Positives = 34/55 (61%) Frame = -2 Query: 685 GRAIGAGPLRYYASWPKGGCAARRLSWVTPRVFPVTTL*NDGPVNCNTTHYRANW 521 GR++ A L + KGGCAARRLSW FP + PVNCNTTHYRANW Sbjct: 43 GRSVRASSLLRQLA--KGGCAARRLSWG----FPSHDVVKRRPVNCNTTHYRANW 91 Score = 29.9 bits (64), Expect = 2.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -3 Query: 696 RNCWEGRSVRA 664 RNCWEGRSVRA Sbjct: 38 RNCWEGRSVRA 48 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 56.0 bits (129), Expect = 3e-08 Identities = 30/55 (54%), Positives = 34/55 (61%) Frame = -2 Query: 685 GRAIGAGPLRYYASWPKGGCAARRLSWVTPRVFPVTTL*NDGPVNCNTTHYRANW 521 GR++ A L + KGGCAARRLSW FP + PVNCNTTHYRANW Sbjct: 43 GRSVRASSLLRQLA--KGGCAARRLSWG----FPSHDVVKRRPVNCNTTHYRANW 91 Score = 29.9 bits (64), Expect = 2.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -3 Query: 696 RNCWEGRSVRA 664 RNCWEGRSVRA Sbjct: 38 RNCWEGRSVRA 48 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 55.6 bits (128), Expect = 4e-08 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = +3 Query: 561 PSFYNVVTGKTLGVTQLNRLAAHPPF 638 PSFYNVVTGK GVTQLNRLAAHPPF Sbjct: 9 PSFYNVVTGKNTGVTQLNRLAAHPPF 34 Score = 33.5 bits (73), Expect = 0.17 Identities = 22/53 (41%), Positives = 27/53 (50%) Frame = +2 Query: 539 SRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 SRITIHW +N G + PF + ++ ARTDRPSQQLR Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLR 53 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 55.6 bits (128), Expect = 4e-08 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = +3 Query: 561 PSFYNVVTGKTLGVTQLNRLAAHPPF 638 PSFYNVVTGK GVTQLNRLAAHPPF Sbjct: 9 PSFYNVVTGKNTGVTQLNRLAAHPPF 34 Score = 33.5 bits (73), Expect = 0.17 Identities = 22/53 (41%), Positives = 27/53 (50%) Frame = +2 Query: 539 SRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 SRITIHW +N G + PF + ++ ARTDRPSQQLR Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLR 53 >SB_58985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 55.2 bits (127), Expect = 5e-08 Identities = 38/93 (40%), Positives = 48/93 (51%), Gaps = 2/93 (2%) Frame = +2 Query: 425 IDFKASLNTFIRTMAKI*LALRSEPN*RGARY--PIRPIVSRITIHWAVVLQRRDWENPG 598 +DF F R +KI L PN RG + P+ ++ AVVLQRRDWENPG Sbjct: 95 VDFDYRYTVFYRIQSKIYPPL--PPNIRGKKIGDPLESTCRHASLALAVVLQRRDWENPG 152 Query: 599 RYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 + PF + ++ ARTDRPSQQLR Sbjct: 153 VTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 184 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 54.8 bits (126), Expect = 6e-08 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = +3 Query: 561 PSFYNVVTGKTLGVTQLNRLAAHPPF 638 PSFYNVVTGK GVTQLNRLAAHPPF Sbjct: 9 PSFYNVVTGKNPGVTQLNRLAAHPPF 34 Score = 36.7 bits (81), Expect = 0.018 Identities = 23/53 (43%), Positives = 28/53 (52%) Frame = +2 Query: 539 SRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 SRITIHW +NPG + PF + ++ ARTDRPSQQLR Sbjct: 2 SRITIHWPSFYNVVTGKNPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLR 53 >SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 54.4 bits (125), Expect = 8e-08 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = -2 Query: 697 AQLLGRAIGAGPLRYYASWPKGGCAARRLSWVTP 596 AQLLG+ GPLRYYASW KG RRLSWVTP Sbjct: 2 AQLLGKGDRCGPLRYYASWRKGDVLQRRLSWVTP 35 Score = 39.5 bits (88), Expect = 0.003 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 639 RKGDVLQGD*VG*RPGFSQSRRCKTTA 559 RKGDVLQ PGFSQSRRCKTTA Sbjct: 21 RKGDVLQRRLSWVTPGFSQSRRCKTTA 47 >SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 54.0 bits (124), Expect = 1e-07 Identities = 31/67 (46%), Positives = 38/67 (56%) Frame = +2 Query: 497 PN*RGARYPIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTD 676 PN R R P+ ++ AVVLQRRDWENPG + PF + ++ ARTD Sbjct: 1 PNDRAQRDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTD 59 Query: 677 RPSQQLR 697 RPSQQLR Sbjct: 60 RPSQQLR 66 >SB_24747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 53.6 bits (123), Expect = 1e-07 Identities = 26/33 (78%), Positives = 26/33 (78%) Frame = +1 Query: 559 GRRFTTS*LGKPWALPNLIALQHIPLSASWRNS 657 GRRFTT GK ALPNLIALQHIP ASWRNS Sbjct: 56 GRRFTTLVTGKTLALPNLIALQHIPHFASWRNS 88 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 53.6 bits (123), Expect = 1e-07 Identities = 29/59 (49%), Positives = 32/59 (54%) Frame = -2 Query: 697 AQLLGRAIGAGPLRYYASWPKGGCAARRLSWVTPRVFPVTTL*NDGPVNCNTTHYRANW 521 AQLLGRAIGAG + KG L + FP + PVNCNTTHYRANW Sbjct: 44 AQLLGRAIGAGLFAITPAGEKGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRANW 102 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 52.8 bits (121), Expect = 3e-07 Identities = 29/58 (50%), Positives = 33/58 (56%) Frame = +2 Query: 524 IRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 +RP+VSRITIHW + P P PAGVIA+ ARTDRPSQQLR Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLA-LPNLIALQHIPLSPAGVIAEEARTDRPSQQLR 89 >SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 52.4 bits (120), Expect = 3e-07 Identities = 22/24 (91%), Positives = 23/24 (95%) Frame = -1 Query: 629 MCCKAIKLGNAQGFPSHDVVKRRP 558 MCCKAIKLGNA+ FPSHDVVKRRP Sbjct: 1 MCCKAIKLGNARVFPSHDVVKRRP 24 >SB_51749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 52.0 bits (119), Expect = 4e-07 Identities = 30/71 (42%), Positives = 38/71 (53%) Frame = -3 Query: 696 RNCWEGRSVRALFAITPAGRKGDVLQGD*VG*RPGFSQSRRCKTTAQ*IVIRLTIGRIGY 517 RNCWEGRSVRA + + KG PGFSQSR CKTT +L G++ Y Sbjct: 47 RNCWEGRSVRACWLLRQLA-KGGCAARRLSWVTPGFSQSRGCKTTTS---AKLACGQVDY 102 Query: 516 RAPRQFGSLRS 484 R +F + R+ Sbjct: 103 RGSLRFSNKRA 113 Score = 35.9 bits (79), Expect = 0.032 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -2 Query: 637 KGGCAARRLSWVTP 596 KGGCAARRLSWVTP Sbjct: 66 KGGCAARRLSWVTP 79 >SB_51748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 52.0 bits (119), Expect = 4e-07 Identities = 30/71 (42%), Positives = 38/71 (53%) Frame = -3 Query: 696 RNCWEGRSVRALFAITPAGRKGDVLQGD*VG*RPGFSQSRRCKTTAQ*IVIRLTIGRIGY 517 RNCWEGRSVRA + + KG PGFSQSR CKTT +L G++ Y Sbjct: 47 RNCWEGRSVRACWLLRQLA-KGGCAARRLSWVTPGFSQSRGCKTTTS---AKLACGQVDY 102 Query: 516 RAPRQFGSLRS 484 R +F + R+ Sbjct: 103 RGSLRFSNKRA 113 Score = 35.9 bits (79), Expect = 0.032 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -2 Query: 637 KGGCAARRLSWVTP 596 KGGCAARRLSWVTP Sbjct: 66 KGGCAARRLSWVTP 79 >SB_26800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 52.0 bits (119), Expect = 4e-07 Identities = 25/43 (58%), Positives = 27/43 (62%) Frame = +1 Query: 559 GRRFTTS*LGKPWALPNLIALQHIPLSASWRNSEEGPHRSPFP 687 GRR GK A+P+L ALQHIP ASWR PHRSPFP Sbjct: 9 GRRVYDVVTGKTLAVPSLNALQHIPHFASWRTYPRSPHRSPFP 51 Score = 31.9 bits (69), Expect = 0.51 Identities = 16/28 (57%), Positives = 17/28 (60%) Frame = +3 Query: 555 TGPSFYNVVTGKTLGVTQLNRLAAHPPF 638 TG Y+VVTGKTL V LN L P F Sbjct: 8 TGRRVYDVVTGKTLAVPSLNALQHIPHF 35 >SB_9428| Best HMM Match : Vicilin_N (HMM E-Value=4.2) Length = 122 Score = 52.0 bits (119), Expect = 4e-07 Identities = 33/70 (47%), Positives = 38/70 (54%) Frame = -3 Query: 696 RNCWEGRSVRALFAITPAGRKGDVLQGD*VG*RPGFSQSRRCKTTAQ*IVIRLTIGRIGY 517 RNCWEGRSVRA + KG PGFSQSRRCKTTA + L + G Sbjct: 3 RNCWEGRSVRASSLLRQLA-KGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRG- 60 Query: 516 RAPRQFGSLR 487 +PRQ G +R Sbjct: 61 -SPRQTGRMR 69 Score = 36.7 bits (81), Expect = 0.018 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = -2 Query: 685 GRAIGAGPLRYYASWPKGGCAARRLSWVTP 596 GR++ A L + KGGCAARRLSWVTP Sbjct: 8 GRSVRASSLLRQLA--KGGCAARRLSWVTP 35 >SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) Length = 110 Score = 51.2 bits (117), Expect = 8e-07 Identities = 32/73 (43%), Positives = 37/73 (50%) Frame = -3 Query: 696 RNCWEGRSVRALFAITPAGRKGDVLQGD*VG*RPGFSQSRRCKTTAQ*IVIRLTIGRIGY 517 RNCWEGRSVRA + KG PGFSQSRRCKTTA + L + G Sbjct: 25 RNCWEGRSVRASSLLRQLA-KGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGS 83 Query: 516 RAPRQFGSLRSAS 478 R F ++ AS Sbjct: 84 PFRRTFNAIEDAS 96 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 50.8 bits (116), Expect = 1e-06 Identities = 27/46 (58%), Positives = 29/46 (63%) Frame = +3 Query: 561 PSFYNVVTGKTLGVTQLNRLAAHPPFGQLA**RRGPAPIALPNSCA 698 PSFYNVVTGKTL + L L H P + PAPIALPNSCA Sbjct: 64 PSFYNVVTGKTLALPNLIAL-QHIPLSPAGVIAKRPAPIALPNSCA 108 Score = 35.1 bits (77), Expect = 0.055 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +1 Query: 586 GKPWALPNLIALQHIPLS 639 GK ALPNLIALQHIPLS Sbjct: 72 GKTLALPNLIALQHIPLS 89 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 50.8 bits (116), Expect = 1e-06 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = +3 Query: 561 PSFYNVVTGKTLGVTQLNRLAAHPPF 638 PSFYNV+ KT GVTQLNRLAAHPPF Sbjct: 9 PSFYNVMLAKTPGVTQLNRLAAHPPF 34 Score = 34.3 bits (75), Expect = 0.096 Identities = 22/53 (41%), Positives = 28/53 (52%) Frame = +2 Query: 539 SRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 SRITIHW + PG + PF + +++ARTDRPSQQLR Sbjct: 2 SRITIHWPSFYNVMLAKTPGVTQLNRLAAHPPFA-SWRNSEKARTDRPSQQLR 53 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 50.8 bits (116), Expect = 1e-06 Identities = 27/46 (58%), Positives = 29/46 (63%) Frame = +3 Query: 561 PSFYNVVTGKTLGVTQLNRLAAHPPFGQLA**RRGPAPIALPNSCA 698 PSFYNVVTGKTL + L L H P + PAPIALPNSCA Sbjct: 59 PSFYNVVTGKTLALPNLIAL-QHIPLSPAGVIAKRPAPIALPNSCA 103 Score = 35.1 bits (77), Expect = 0.055 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +1 Query: 586 GKPWALPNLIALQHIPLS 639 GK ALPNLIALQHIPLS Sbjct: 67 GKTLALPNLIALQHIPLS 84 >SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 29 Score = 50.0 bits (114), Expect = 2e-06 Identities = 22/28 (78%), Positives = 25/28 (89%), Gaps = 1/28 (3%) Frame = -2 Query: 253 CGVISPRFDVPINDIERW-TNLLPSRQF 173 CGVISPRFDV + DIE+W +NLLPSRQF Sbjct: 1 CGVISPRFDVGVRDIEQWASNLLPSRQF 28 >SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 50.0 bits (114), Expect = 2e-06 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +3 Query: 570 YNVVTGKTLGVTQLNRLAAHPPF 638 YNVVTGKT GVTQLNRLAAHPPF Sbjct: 12 YNVVTGKTPGVTQLNRLAAHPPF 34 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 50.0 bits (114), Expect = 2e-06 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = +3 Query: 561 PSFYNVVTGKTLGVTQLNRLAAHPPF 638 P+FYN TGKTL TQLNRLAAHPPF Sbjct: 52 PAFYNAPTGKTLAYTQLNRLAAHPPF 77 Score = 41.5 bits (93), Expect = 6e-04 Identities = 25/59 (42%), Positives = 31/59 (52%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 PIRPIVSRITIHW + Y + + P + ++ AR DRPSQQLR Sbjct: 39 PIRPIVSRITIHWPAFYNAPTGKTLA-YTQLNRLAAHPPFASWRNSQEARADRPSQQLR 96 >SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 50.0 bits (114), Expect = 2e-06 Identities = 27/46 (58%), Positives = 31/46 (67%) Frame = +2 Query: 560 AVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 AVVLQRRDWENPG + PF G +++ARTDRPSQQLR Sbjct: 132 AVVLQRRDWENPGVTQLNRLAAHPPFASWG-NSEKARTDRPSQQLR 176 Score = 34.3 bits (75), Expect = 0.096 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +3 Query: 597 GVTQLNRLAAHPPF 638 GVTQLNRLAAHPPF Sbjct: 144 GVTQLNRLAAHPPF 157 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 49.6 bits (113), Expect = 2e-06 Identities = 29/64 (45%), Positives = 36/64 (56%) Frame = +2 Query: 506 RGARYPIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPS 685 R A P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPS Sbjct: 14 RAAGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPS 72 Query: 686 QQLR 697 QQLR Sbjct: 73 QQLR 76 >SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 49.6 bits (113), Expect = 2e-06 Identities = 33/73 (45%), Positives = 39/73 (53%) Frame = -3 Query: 696 RNCWEGRSVRALFAITPAGRKGDVLQGD*VG*RPGFSQSRRCKTTAQ*IVIRLTIGRIGY 517 RNCWEGRSVRA + KG PGFSQSRRCKTTA + L + G Sbjct: 3 RNCWEGRSVRASSLLRQLA-KGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRG- 60 Query: 516 RAPRQFGSLRSAS 478 +P Q+ LR +S Sbjct: 61 -SPAQWYGLRFSS 72 Score = 36.7 bits (81), Expect = 0.018 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = -2 Query: 685 GRAIGAGPLRYYASWPKGGCAARRLSWVTP 596 GR++ A L + KGGCAARRLSWVTP Sbjct: 8 GRSVRASSLLRQLA--KGGCAARRLSWVTP 35 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 49.6 bits (113), Expect = 2e-06 Identities = 30/73 (41%), Positives = 40/73 (54%) Frame = +2 Query: 479 LALRSEPN*RGARYPIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIA 658 + LR++ R P+ ++ AVVLQRRDWENPG + PF + + Sbjct: 10 ILLRNDRKSRHRGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNS 68 Query: 659 KRARTDRPSQQLR 697 + ARTDRPSQQLR Sbjct: 69 EEARTDRPSQQLR 81 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 49.6 bits (113), Expect = 2e-06 Identities = 32/71 (45%), Positives = 35/71 (49%) Frame = -3 Query: 696 RNCWEGRSVRALFAITPAGRKGDVLQGD*VG*RPGFSQSRRCKTTAQ*IVIRLTIGRIGY 517 RNCWEGRSVRA + KG PGFSQSRRCKTTA + L + G Sbjct: 25 RNCWEGRSVRASSLLRQLA-KGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGS 83 Query: 516 RAPRQFGSLRS 484 G LRS Sbjct: 84 PLLLDIGDLRS 94 Score = 36.7 bits (81), Expect = 0.018 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = -2 Query: 685 GRAIGAGPLRYYASWPKGGCAARRLSWVTP 596 GR++ A L + KGGCAARRLSWVTP Sbjct: 30 GRSVRASSLLRQLA--KGGCAARRLSWVTP 57 >SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 49.6 bits (113), Expect = 2e-06 Identities = 31/68 (45%), Positives = 37/68 (54%) Frame = -3 Query: 696 RNCWEGRSVRALFAITPAGRKGDVLQGD*VG*RPGFSQSRRCKTTAQ*IVIRLTIGRIGY 517 RNCWEGRSVRA + KG PGFSQSRRCKTTA + L + G Sbjct: 3 RNCWEGRSVRASSLLRQLA-KGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRG- 60 Query: 516 RAPRQFGS 493 +P Q+G+ Sbjct: 61 -SPSQYGT 67 Score = 36.7 bits (81), Expect = 0.018 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = -2 Query: 685 GRAIGAGPLRYYASWPKGGCAARRLSWVTP 596 GR++ A L + KGGCAARRLSWVTP Sbjct: 8 GRSVRASSLLRQLA--KGGCAARRLSWVTP 35 >SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) Length = 657 Score = 49.6 bits (113), Expect = 2e-06 Identities = 28/61 (45%), Positives = 35/61 (57%) Frame = +2 Query: 515 RYPIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQL 694 +YP ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQL Sbjct: 20 KYPPESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQL 78 Query: 695 R 697 R Sbjct: 79 R 79 >SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) Length = 157 Score = 49.6 bits (113), Expect = 2e-06 Identities = 37/81 (45%), Positives = 42/81 (51%), Gaps = 2/81 (2%) Frame = -3 Query: 696 RNCWEGRSVRALFAITPAGRKGDVLQGD*VG*RPGFSQSRRCKTTAQ*IVIRLTIGRIGY 517 RNCWEGRSVRA + KG PGFSQSRRCKTTA + L + G Sbjct: 25 RNCWEGRSVRASSLLRQLA-KGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGS 83 Query: 516 RA--PRQFGSLRSAS*ILAMV 460 A R G RS S I+AM+ Sbjct: 84 PADDSRLLGIPRSRS-IIAMI 103 Score = 36.7 bits (81), Expect = 0.018 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = -2 Query: 685 GRAIGAGPLRYYASWPKGGCAARRLSWVTP 596 GR++ A L + KGGCAARRLSWVTP Sbjct: 30 GRSVRASSLLRQLA--KGGCAARRLSWVTP 57 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 49.2 bits (112), Expect = 3e-06 Identities = 27/46 (58%), Positives = 30/46 (65%) Frame = +2 Query: 560 AVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 AVVLQRRDWENPG + PF G ++ ARTDRPSQQLR Sbjct: 68 AVVLQRRDWENPGVTQLNRLAAHPPFASWG-NSEEARTDRPSQQLR 112 Score = 34.3 bits (75), Expect = 0.096 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +3 Query: 597 GVTQLNRLAAHPPF 638 GVTQLNRLAAHPPF Sbjct: 80 GVTQLNRLAAHPPF 93 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 49.2 bits (112), Expect = 3e-06 Identities = 31/73 (42%), Positives = 41/73 (56%), Gaps = 2/73 (2%) Frame = +2 Query: 485 LRSEPN*RGARY--PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIA 658 L+ E N R ++ P+ ++ AVVLQRRDWENPG + PF + + Sbjct: 62 LKIERNRRHRKFGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNS 120 Query: 659 KRARTDRPSQQLR 697 + ARTDRPSQQLR Sbjct: 121 EEARTDRPSQQLR 133 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 49.2 bits (112), Expect = 3e-06 Identities = 31/71 (43%), Positives = 38/71 (53%) Frame = +2 Query: 485 LRSEPN*RGARYPIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKR 664 L PN G P+ ++ AVVLQRRDWENPG + PF + ++ Sbjct: 69 LNPNPNPNGD--PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEE 125 Query: 665 ARTDRPSQQLR 697 ARTDRPSQQLR Sbjct: 126 ARTDRPSQQLR 136 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 49.2 bits (112), Expect = 3e-06 Identities = 32/79 (40%), Positives = 43/79 (54%) Frame = -3 Query: 696 RNCWEGRSVRALFAITPAGRKGDVLQGD*VG*RPGFSQSRRCKTTAQ*IVIRLTIGRIGY 517 RNCWEGRSVRA + KG PGFSQSRRCKTTA + L + G Sbjct: 791 RNCWEGRSVRASSLLRQLA-KGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRG- 848 Query: 516 RAPRQFGSLRSAS*ILAMV 460 +P S+R+++ +L ++ Sbjct: 849 -SPNCVFSIRNSACVLPVI 866 Score = 36.7 bits (81), Expect = 0.018 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = -2 Query: 685 GRAIGAGPLRYYASWPKGGCAARRLSWVTP 596 GR++ A L + KGGCAARRLSWVTP Sbjct: 796 GRSVRASSLLRQLA--KGGCAARRLSWVTP 823 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 49.2 bits (112), Expect = 3e-06 Identities = 29/68 (42%), Positives = 38/68 (55%) Frame = +2 Query: 494 EPN*RGARYPIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRART 673 +PN + P+ ++ AVVLQRRDWENPG + PF + ++ ART Sbjct: 105 QPNSQPDGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEART 163 Query: 674 DRPSQQLR 697 DRPSQQLR Sbjct: 164 DRPSQQLR 171 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 49.2 bits (112), Expect = 3e-06 Identities = 39/106 (36%), Positives = 48/106 (45%) Frame = -3 Query: 696 RNCWEGRSVRALFAITPAGRKGDVLQGD*VG*RPGFSQSRRCKTTAQ*IVIRLTIGRIGY 517 RNCWEGRSVRA + KG PGFSQSRRCKTTA + L + G Sbjct: 25 RNCWEGRSVRASSLLRQLA-KGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRG- 82 Query: 516 RAPRQFGSLRSAS*ILAMVRMNVLSDALKSIHNAEKRGKRQVLIRP 379 +P ++G S A + +L LK K L+RP Sbjct: 83 -SPLRWGPHASKISDKANKVLGLLRRTLKPCSQLVKERAYFTLVRP 127 Score = 36.7 bits (81), Expect = 0.018 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = -2 Query: 685 GRAIGAGPLRYYASWPKGGCAARRLSWVTP 596 GR++ A L + KGGCAARRLSWVTP Sbjct: 30 GRSVRASSLLRQLA--KGGCAARRLSWVTP 57 >SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) Length = 152 Score = 49.2 bits (112), Expect = 3e-06 Identities = 32/67 (47%), Positives = 38/67 (56%), Gaps = 4/67 (5%) Frame = +2 Query: 509 GARYPIRPIVSRITIHW----AVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTD 676 G YP P SR + + AVVLQRRDWENPG + PF + ++ ARTD Sbjct: 42 GLNYPFVPKSSRHSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTD 100 Query: 677 RPSQQLR 697 RPSQQLR Sbjct: 101 RPSQQLR 107 Score = 34.3 bits (75), Expect = 0.096 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +3 Query: 597 GVTQLNRLAAHPPF 638 GVTQLNRLAAHPPF Sbjct: 75 GVTQLNRLAAHPPF 88 >SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 49.2 bits (112), Expect = 3e-06 Identities = 27/46 (58%), Positives = 30/46 (65%) Frame = +2 Query: 560 AVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 AVVLQRRDWENPG + PF G ++ ARTDRPSQQLR Sbjct: 53 AVVLQRRDWENPGVTQLNRLAAHPPFTSWG-NSEEARTDRPSQQLR 97 Score = 34.3 bits (75), Expect = 0.096 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +3 Query: 597 GVTQLNRLAAHPPF 638 GVTQLNRLAAHPPF Sbjct: 65 GVTQLNRLAAHPPF 78 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 48.8 bits (111), Expect = 4e-06 Identities = 28/61 (45%), Positives = 35/61 (57%) Frame = +2 Query: 515 RYPIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQL 694 R P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQL Sbjct: 94 RDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQL 152 Query: 695 R 697 R Sbjct: 153 R 153 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 48.8 bits (111), Expect = 4e-06 Identities = 29/71 (40%), Positives = 38/71 (53%) Frame = +2 Query: 485 LRSEPN*RGARYPIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKR 664 + E N + P+ ++ AVVLQRRDWENPG + PF + ++ Sbjct: 52 INGEDNNQDPGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEE 110 Query: 665 ARTDRPSQQLR 697 ARTDRPSQQLR Sbjct: 111 ARTDRPSQQLR 121 >SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 48.8 bits (111), Expect = 4e-06 Identities = 30/64 (46%), Positives = 33/64 (51%) Frame = -3 Query: 696 RNCWEGRSVRALFAITPAGRKGDVLQGD*VG*RPGFSQSRRCKTTAQ*IVIRLTIGRIGY 517 RNCWEGRSVRA + KG PGFSQSRRCKTTA + L + G Sbjct: 3 RNCWEGRSVRASSLLRQLA-KGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGS 61 Query: 516 RAPR 505 PR Sbjct: 62 PMPR 65 Score = 36.7 bits (81), Expect = 0.018 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = -2 Query: 685 GRAIGAGPLRYYASWPKGGCAARRLSWVTP 596 GR++ A L + KGGCAARRLSWVTP Sbjct: 8 GRSVRASSLLRQLA--KGGCAARRLSWVTP 35 >SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 48.8 bits (111), Expect = 4e-06 Identities = 29/54 (53%), Positives = 34/54 (62%) Frame = +2 Query: 536 VSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 +SRIT AVVLQRRDWEN G + PF + ++ ARTDRPSQQLR Sbjct: 88 LSRITNSLAVVLQRRDWENTGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 140 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 48.8 bits (111), Expect = 4e-06 Identities = 28/61 (45%), Positives = 35/61 (57%) Frame = +2 Query: 515 RYPIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQL 694 R P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQL Sbjct: 57 RDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQL 115 Query: 695 R 697 R Sbjct: 116 R 116 >SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) Length = 783 Score = 48.8 bits (111), Expect = 4e-06 Identities = 28/64 (43%), Positives = 36/64 (56%) Frame = +2 Query: 506 RGARYPIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPS 685 +G P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPS Sbjct: 702 QGVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPS 760 Query: 686 QQLR 697 QQLR Sbjct: 761 QQLR 764 >SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 48.8 bits (111), Expect = 4e-06 Identities = 28/61 (45%), Positives = 35/61 (57%) Frame = +2 Query: 515 RYPIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQL 694 R P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQL Sbjct: 10 RDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQL 68 Query: 695 R 697 R Sbjct: 69 R 69 >SB_7086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 48.8 bits (111), Expect = 4e-06 Identities = 27/46 (58%), Positives = 30/46 (65%) Frame = +2 Query: 560 AVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 AVVLQRRDWENPG + PF G ++ARTDRPSQQLR Sbjct: 30 AVVLQRRDWENPGVTQLNRLAAHPPFASWG-NNEKARTDRPSQQLR 74 Score = 34.3 bits (75), Expect = 0.096 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +3 Query: 597 GVTQLNRLAAHPPF 638 GVTQLNRLAAHPPF Sbjct: 42 GVTQLNRLAAHPPF 55 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 48.4 bits (110), Expect = 6e-06 Identities = 28/64 (43%), Positives = 36/64 (56%) Frame = +2 Query: 506 RGARYPIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPS 685 +G P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPS Sbjct: 1173 QGKGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPS 1231 Query: 686 QQLR 697 QQLR Sbjct: 1232 QQLR 1235 Score = 30.3 bits (65), Expect = 1.6 Identities = 15/27 (55%), Positives = 18/27 (66%) Frame = -2 Query: 685 GRAIGAGPLRYYASWPKGGCAARRLSW 605 GR++ A L + KGGCAARRLSW Sbjct: 415 GRSVRASSLLRQLA--KGGCAARRLSW 439 Score = 29.9 bits (64), Expect = 2.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -3 Query: 696 RNCWEGRSVRA 664 RNCWEGRSVRA Sbjct: 410 RNCWEGRSVRA 420 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 48.4 bits (110), Expect = 6e-06 Identities = 28/67 (41%), Positives = 37/67 (55%) Frame = +2 Query: 497 PN*RGARYPIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTD 676 P + + P+ ++ AVVLQRRDWENPG + PF + ++ ARTD Sbjct: 39 PTIKASGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTD 97 Query: 677 RPSQQLR 697 RPSQQLR Sbjct: 98 RPSQQLR 104 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 48.4 bits (110), Expect = 6e-06 Identities = 28/63 (44%), Positives = 35/63 (55%) Frame = +2 Query: 509 GARYPIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQ 688 G P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQ Sbjct: 88 GVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQ 146 Query: 689 QLR 697 QLR Sbjct: 147 QLR 149 >SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) Length = 283 Score = 48.4 bits (110), Expect = 6e-06 Identities = 29/65 (44%), Positives = 34/65 (52%) Frame = -3 Query: 696 RNCWEGRSVRALFAITPAGRKGDVLQGD*VG*RPGFSQSRRCKTTAQ*IVIRLTIGRIGY 517 RNCWEGRSVRA + KG PGFSQSRRCKTTA + L + G Sbjct: 101 RNCWEGRSVRASSLLRQLA-KGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGS 159 Query: 516 RAPRQ 502 P++ Sbjct: 160 PGPKR 164 Score = 36.7 bits (81), Expect = 0.018 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = -2 Query: 685 GRAIGAGPLRYYASWPKGGCAARRLSWVTP 596 GR++ A L + KGGCAARRLSWVTP Sbjct: 106 GRSVRASSLLRQLA--KGGCAARRLSWVTP 133 >SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) Length = 130 Score = 48.4 bits (110), Expect = 6e-06 Identities = 31/69 (44%), Positives = 36/69 (52%) Frame = -3 Query: 696 RNCWEGRSVRALFAITPAGRKGDVLQGD*VG*RPGFSQSRRCKTTAQ*IVIRLTIGRIGY 517 RNCWEGRSVRA + KG PGFSQSRRCKTTA + L + G Sbjct: 25 RNCWEGRSVRASSLLRQLA-KGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRG- 82 Query: 516 RAPRQFGSL 490 +P G+L Sbjct: 83 -SPNDMGTL 90 Score = 36.7 bits (81), Expect = 0.018 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = -2 Query: 685 GRAIGAGPLRYYASWPKGGCAARRLSWVTP 596 GR++ A L + KGGCAARRLSWVTP Sbjct: 30 GRSVRASSLLRQLA--KGGCAARRLSWVTP 57 >SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 48.4 bits (110), Expect = 6e-06 Identities = 28/59 (47%), Positives = 37/59 (62%), Gaps = 3/59 (5%) Frame = +2 Query: 530 PIVSRITIHW---AVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P++ R+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 50 PVMGRLESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 107 Score = 34.3 bits (75), Expect = 0.096 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +3 Query: 597 GVTQLNRLAAHPPF 638 GVTQLNRLAAHPPF Sbjct: 75 GVTQLNRLAAHPPF 88 >SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 48.4 bits (110), Expect = 6e-06 Identities = 33/77 (42%), Positives = 38/77 (49%), Gaps = 7/77 (9%) Frame = -3 Query: 696 RNCWEGRSVRALFAITPAGRKGDVLQGD*VG*RPGFSQSRRCKTTAQ*IVIRLTIGRIG- 520 RNCWEGRSVRA + KG PGFSQSRRCKTTA + L + G Sbjct: 25 RNCWEGRSVRASSLLRQLA-KGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGS 83 Query: 519 ------YRAPRQFGSLR 487 Y P ++GS R Sbjct: 84 PNRNHTYGLPNRYGSTR 100 Score = 36.7 bits (81), Expect = 0.018 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = -2 Query: 685 GRAIGAGPLRYYASWPKGGCAARRLSWVTP 596 GR++ A L + KGGCAARRLSWVTP Sbjct: 30 GRSVRASSLLRQLA--KGGCAARRLSWVTP 57 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 48.4 bits (110), Expect = 6e-06 Identities = 28/63 (44%), Positives = 35/63 (55%) Frame = +2 Query: 509 GARYPIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQ 688 G P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQ Sbjct: 53 GVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQ 111 Query: 689 QLR 697 QLR Sbjct: 112 QLR 114 >SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) Length = 118 Score = 48.4 bits (110), Expect = 6e-06 Identities = 31/67 (46%), Positives = 34/67 (50%) Frame = -3 Query: 696 RNCWEGRSVRALFAITPAGRKGDVLQGD*VG*RPGFSQSRRCKTTAQ*IVIRLTIGRIGY 517 RNCWEGRSVRA + KG PGFSQSRRCKTTA + L + G Sbjct: 25 RNCWEGRSVRASSLLRQLA-KGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGS 83 Query: 516 RAPRQFG 496 A R G Sbjct: 84 PAIRHSG 90 Score = 36.7 bits (81), Expect = 0.018 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = -2 Query: 685 GRAIGAGPLRYYASWPKGGCAARRLSWVTP 596 GR++ A L + KGGCAARRLSWVTP Sbjct: 30 GRSVRASSLLRQLA--KGGCAARRLSWVTP 57 Score = 31.5 bits (68), Expect = 0.68 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 688 LGRAIGAGPLRYYASWPKG 632 +G+ GPLRYYASW KG Sbjct: 94 VGKGDRCGPLRYYASWRKG 112 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -1 Query: 695 ATVGKGDRCGP 663 ATVGKGDRCGP Sbjct: 92 ATVGKGDRCGP 102 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 50 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 107 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 13 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 70 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 37 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 94 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 16 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 73 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 61 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 17 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 74 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 6 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 63 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 61 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 821 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 878 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 61 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 102 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 159 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 27 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 84 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 65 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 82 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 7 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 64 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 76 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 133 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 82 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 120 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 177 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 10 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 67 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 141 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 198 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 45 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 102 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 9 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 66 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 48 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 105 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 61 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 21 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 78 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 36 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 93 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 28 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 85 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 63 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 120 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 10 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 67 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 45 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 102 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 88 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 145 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 118 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 16 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 73 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 134 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 191 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 47 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 104 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 88 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 145 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 20 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 77 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 113 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 170 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 65 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 122 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 19 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 76 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 61 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 22 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 79 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 24 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 81 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 84 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 141 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 49 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 106 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 72 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 129 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 28 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 85 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 72 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 129 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 72 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 129 >SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 9 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 66 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 53 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 110 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 12 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 69 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 61 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 12 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 69 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 31 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 88 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 55 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 112 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 29 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 86 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 1051 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 1108 >SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 5 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 62 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 19 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 76 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 122 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 179 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 170 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 227 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 158 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 215 >SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 7 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 64 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 134 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 191 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 46 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 103 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 48.0 bits (109), Expect = 7e-06 Identities = 29/65 (44%), Positives = 34/65 (52%) Frame = -3 Query: 696 RNCWEGRSVRALFAITPAGRKGDVLQGD*VG*RPGFSQSRRCKTTAQ*IVIRLTIGRIGY 517 RNCWEGRSVRA + KG PGFSQSRRCKTTA + L + G Sbjct: 25 RNCWEGRSVRASSLLRQLA-KGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGS 83 Query: 516 RAPRQ 502 P++ Sbjct: 84 PCPQR 88 Score = 36.7 bits (81), Expect = 0.018 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = -2 Query: 685 GRAIGAGPLRYYASWPKGGCAARRLSWVTP 596 GR++ A L + KGGCAARRLSWVTP Sbjct: 30 GRSVRASSLLRQLA--KGGCAARRLSWVTP 57 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 104 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 161 >SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) Length = 631 Score = 48.0 bits (109), Expect = 7e-06 Identities = 28/56 (50%), Positives = 31/56 (55%) Frame = -3 Query: 696 RNCWEGRSVRALFAITPAGRKGDVLQGD*VG*RPGFSQSRRCKTTAQ*IVIRLTIG 529 RNCWEGRSVRA + KG PGFSQSRRCKTTA + L +G Sbjct: 452 RNCWEGRSVRASSLLRQLA-KGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVG 506 Score = 36.7 bits (81), Expect = 0.018 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = -2 Query: 685 GRAIGAGPLRYYASWPKGGCAARRLSWVTP 596 GR++ A L + KGGCAARRLSWVTP Sbjct: 457 GRSVRASSLLRQLA--KGGCAARRLSWVTP 484 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 11 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 68 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 640 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 697 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 27 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 84 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 149 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 206 >SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 35 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 92 >SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 20 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 77 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 10 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 67 >SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 46 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 103 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 58 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 115 >SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 5 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 62 >SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 48 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 105 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 59 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 116 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 67 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 124 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 173 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 230 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 118 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 254 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 311 >SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 65 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 22 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 79 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 49 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 106 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 58 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 115 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 92 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 149 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 51 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 108 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 118 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 118 >SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 5 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 62 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 62 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 119 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 71 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 128 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 164 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 221 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 71 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 128 >SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 65 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 37 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 94 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 118 >SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) Length = 197 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 130 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 187 >SB_22375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 16 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 73 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 56 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 113 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 45 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 102 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 57 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 114 >SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 65 >SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 61 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 26 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 83 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 32 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 89 >SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 27 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 84 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 50 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 107 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 69 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 126 >SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) Length = 571 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 179 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 236 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 75 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 132 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 26 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 83 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 38 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 95 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 37 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 94 >SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 29 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 86 >SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 10 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 67 >SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 65 >SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 31 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 88 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 57 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 114 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 43 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 100 >SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 6 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 63 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 42 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 99 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 76 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 133 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 43 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 100 >SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 46 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 103 >SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 65 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 82 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 139 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 53 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 110 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 155 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 212 >SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 50 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 107 >SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 48.0 bits (109), Expect = 7e-06 Identities = 26/46 (56%), Positives = 29/46 (63%) Frame = -3 Query: 696 RNCWEGRSVRALFAITPAGRKGDVLQGD*VG*RPGFSQSRRCKTTA 559 RNCWEGRSVRA +++ KG PGFSQSRRCKTTA Sbjct: 3 RNCWEGRSVRA-YSLFRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 47 Score = 37.1 bits (82), Expect = 0.014 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = -2 Query: 685 GRAIGAGPLRYYASWPKGGCAARRLSWVTP 596 GR++ A L + KGGCAARRLSWVTP Sbjct: 8 GRSVRAYSL--FRQLAKGGCAARRLSWVTP 35 >SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 30 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 87 >SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 5 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 62 >SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 21 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 78 >SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 48.0 bits (109), Expect = 7e-06 Identities = 30/69 (43%), Positives = 34/69 (49%) Frame = -3 Query: 696 RNCWEGRSVRALFAITPAGRKGDVLQGD*VG*RPGFSQSRRCKTTAQ*IVIRLTIGRIGY 517 RNCWEGRSVRA + KG PGFSQSRRCKTTA + L + G Sbjct: 3 RNCWEGRSVRASSLLRQLA-KGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGS 61 Query: 516 RAPRQFGSL 490 FG + Sbjct: 62 PCQNIFGRM 70 Score = 36.7 bits (81), Expect = 0.018 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = -2 Query: 685 GRAIGAGPLRYYASWPKGGCAARRLSWVTP 596 GR++ A L + KGGCAARRLSWVTP Sbjct: 8 GRSVRASSLLRQLA--KGGCAARRLSWVTP 35 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 67 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 124 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 45 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 102 >SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 22 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 79 >SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) Length = 186 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 93 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 150 >SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 34 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 91 >SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 107 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 164 >SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) Length = 233 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 140 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 197 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 90 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 147 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 22 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 79 >SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 14 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 71 >SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 43 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 100 >SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 82 >SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 44 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 101 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 144 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 201 >SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) Length = 150 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 57 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 114 >SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 114 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 171 >SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 46 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 103 >SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 77 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 134 >SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 6 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 63 >SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) Length = 322 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 14 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 71 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 73 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 130 >SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 32 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 89 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 81 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 138 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 133 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 190 >SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 60 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 117 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 81 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 138 >SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) Length = 110 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 43 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 100 >SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 95 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 152 >SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 61 >SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 48.0 bits (109), Expect = 7e-06 Identities = 32/71 (45%), Positives = 38/71 (53%) Frame = -3 Query: 696 RNCWEGRSVRALFAITPAGRKGDVLQGD*VG*RPGFSQSRRCKTTAQ*IVIRLTIGRIGY 517 RNCWEGRSVRA + KG PGFSQSRRCKTTA + L + G Sbjct: 3 RNCWEGRSVRASSLLRQLA-KGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRG- 60 Query: 516 RAPRQFGSLRS 484 +P + G+L S Sbjct: 61 -SPGKRGALSS 70 Score = 36.7 bits (81), Expect = 0.018 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = -2 Query: 685 GRAIGAGPLRYYASWPKGGCAARRLSWVTP 596 GR++ A L + KGGCAARRLSWVTP Sbjct: 8 GRSVRASSLLRQLA--KGGCAARRLSWVTP 35 >SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) Length = 162 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 69 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 126 >SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) Length = 189 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 96 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 153 >SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 61 >SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) Length = 387 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 294 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 351 >SB_51352| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 51 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 108 >SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 18 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 75 >SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 40 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 97 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 3 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 60 >SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 521 PIRPIVSRITIHWAVVLQRRDWENPGRYPT*SPCSTSPFRPAGVIAKRARTDRPSQQLR 697 P+ ++ AVVLQRRDWENPG + PF + ++ ARTDRPSQQLR Sbjct: 14 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF-ASWRNSEEARTDRPSQQLR 71 >SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) Length = 128 Score = 48.0 bits (109), Expect = 7e-06 Identities = 31/66 (46%), Positives = 35/66 (53%), Gaps = 1/66 (1%) Frame = -3 Query: 696 RNCWEGRSVRALFAITPAGRKGDVLQGD*VG*RPGFSQSRRCKTTAQ*IVIRLTIGRIGY 517 RNCWEGRSVRA + KG PGFSQSRRCKTTA + L + G Sbjct: 3 RNCWEGRSVRASSLLRQLA-KGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGS 61 Query: 516 -RAPRQ 502 + PRQ Sbjct: 62 PQGPRQ 67 Score = 36.7 bits (81), Expect = 0.018 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = -2 Query: 685 GRAIGAGPLRYYASWPKGGCAARRLSWVTP 596 GR++ A L + KGGCAARRLSWVTP Sbjct: 8 GRSVRASSLLRQLA--KGGCAARRLSWVTP 35 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,281,734 Number of Sequences: 59808 Number of extensions: 430806 Number of successful extensions: 14460 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4750 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8584 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -