BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30606.Seq (698 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF025460-6|AAB70989.1| 130|Caenorhabditis elegans Ribosomal pro... 135 3e-32 U00032-8|AAA50632.2| 1163|Caenorhabditis elegans Hypothetical pr... 29 2.4 Z81066-3|CAI46608.1| 363|Caenorhabditis elegans Hypothetical pr... 27 9.8 >AF025460-6|AAB70989.1| 130|Caenorhabditis elegans Ribosomal protein, small subunitprotein 22 protein. Length = 130 Score = 135 bits (326), Expect = 3e-32 Identities = 67/76 (88%), Positives = 72/76 (94%), Gaps = 2/76 (2%) Frame = -3 Query: 465 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMKHGYIGEFEIVDDHRAGK 286 MVRMNVL+DAL +I+NAEKRGKRQVLIRP SKVIV+FLTVMMKHGYIGEFEIVDDHRAGK Sbjct: 1 MVRMNVLADALNAINNAEKRGKRQVLIRPASKVIVRFLTVMMKHGYIGEFEIVDDHRAGK 60 Query: 285 IVVNLTGRLN--SVVS 244 IVVNLTGRLN SV+S Sbjct: 61 IVVNLTGRLNKASVIS 76 Score = 102 bits (244), Expect = 3e-22 Identities = 46/60 (76%), Positives = 54/60 (90%), Gaps = 1/60 (1%) Frame = -2 Query: 256 QCGVISPRFDVPINDIERWTN-LLPSRQFGYLVLTTSGGIMDHEEARRKHLGGKILGFFF 80 + VISPR ++ +ND+E++TN LLPSRQFGYL+LTTS GIMDHEEARRKHLGGKILGFFF Sbjct: 71 KASVISPRLNIRLNDLEKYTNTLLPSRQFGYLILTTSAGIMDHEEARRKHLGGKILGFFF 130 >U00032-8|AAA50632.2| 1163|Caenorhabditis elegans Hypothetical protein F37A4.4 protein. Length = 1163 Score = 29.5 bits (63), Expect = 2.4 Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 2/62 (3%) Frame = -3 Query: 453 NVLSDALKSIH--NAEKRGKRQVLIRPCSKVIVKFLTVMMKHGYIGEFEIVDDHRAGKIV 280 NVL D+++ I+ N K KR I C+K L V + GY EI+ H A + Sbjct: 826 NVLIDSVREINATNLLKAVKRGAYINVCNKYGNTALHVATRRGYQNLVEILIKHGADRSF 885 Query: 279 VN 274 +N Sbjct: 886 LN 887 >Z81066-3|CAI46608.1| 363|Caenorhabditis elegans Hypothetical protein F17B5.6 protein. Length = 363 Score = 27.5 bits (58), Expect = 9.8 Identities = 9/14 (64%), Positives = 10/14 (71%), Gaps = 1/14 (7%) Frame = -1 Query: 182 TTVWL-PSPYNKWW 144 T +WL P PYN WW Sbjct: 29 TVIWLIPRPYNYWW 42 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,749,999 Number of Sequences: 27780 Number of extensions: 303208 Number of successful extensions: 650 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 638 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 649 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1613473434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -