BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30598.Seq (847 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45627| Best HMM Match : AAA (HMM E-Value=0) 135 4e-32 SB_14682| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_33584| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_3919| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_9909| Best HMM Match : AAA (HMM E-Value=0) 69 4e-12 SB_33442| Best HMM Match : AAA (HMM E-Value=0) 62 5e-10 SB_48561| Best HMM Match : AAA (HMM E-Value=0) 58 7e-09 SB_35973| Best HMM Match : zf-CCHC (HMM E-Value=0.0026) 56 4e-08 SB_49367| Best HMM Match : AAA (HMM E-Value=0) 52 8e-07 SB_40956| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_37200| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_19460| Best HMM Match : AAA (HMM E-Value=0) 45 7e-05 SB_30385| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_55690| Best HMM Match : AAA (HMM E-Value=0) 44 2e-04 SB_35704| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_56202| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_7424| Best HMM Match : AAA (HMM E-Value=0) 41 0.001 SB_33907| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_17703| Best HMM Match : Mito_carr (HMM E-Value=0) 37 0.018 SB_3115| Best HMM Match : AAA (HMM E-Value=0) 35 0.072 SB_28977| Best HMM Match : AAA (HMM E-Value=0) 33 0.22 SB_732| Best HMM Match : AAA (HMM E-Value=0) 30 2.1 SB_32255| Best HMM Match : Spectrin (HMM E-Value=0.23) 28 8.3 SB_22720| Best HMM Match : KID (HMM E-Value=0.0014) 28 8.3 SB_38103| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 >SB_45627| Best HMM Match : AAA (HMM E-Value=0) Length = 628 Score = 135 bits (327), Expect = 4e-32 Identities = 59/65 (90%), Positives = 64/65 (98%) Frame = +3 Query: 510 VRGGMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 689 VRGGMRAVEFKV+ETDPSP+CIVAPDTVIHC+GEP+KREEEEE+LN VGYDDIGGCRKQL Sbjct: 108 VRGGMRAVEFKVIETDPSPYCIVAPDTVIHCEGEPVKREEEEESLNEVGYDDIGGCRKQL 167 Query: 690 AQIKE 704 AQIKE Sbjct: 168 AQIKE 172 Score = 101 bits (241), Expect = 1e-21 Identities = 46/59 (77%), Positives = 56/59 (94%) Frame = +2 Query: 80 DDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKRRKETV 256 D+L+TAIL+ K RPNRL+VEEAV+DDNSVV +SQAKME+LQLFRGDTVL+KGK+RK+TV Sbjct: 5 DELATAILKNKSRPNRLLVEEAVNDDNSVVTMSQAKMEELQLFRGDTVLIKGKKRKDTV 63 Score = 58.0 bits (134), Expect = 9e-09 Identities = 28/65 (43%), Positives = 38/65 (58%) Frame = +3 Query: 621 REEEEEALNAVGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPHGGILMYGAAGTG 800 RE E N V +DDIGG +++E+V+ P+ HP F G+ P G+L YG G G Sbjct: 298 RETVVEVPN-VSWDDIGGLEGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCG 356 Query: 801 KTLIA 815 KTL+A Sbjct: 357 KTLLA 361 Score = 31.9 bits (69), Expect = 0.67 Identities = 17/43 (39%), Positives = 21/43 (48%) Frame = +1 Query: 223 LAQGQTPQGNRCIVLSDDNCPDEKIRMXXXXXXXXXXXXSDVV 351 L +G+ + CIVLSDD D+KIRM DVV Sbjct: 53 LIKGKKRKDTVCIVLSDDTISDDKIRMNRVVRMNLRVRLGDVV 95 >SB_14682| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 802 Score = 77.4 bits (182), Expect = 1e-14 Identities = 37/75 (49%), Positives = 50/75 (66%) Frame = +3 Query: 591 VIHCDGEPIKREEEEEALNAVGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPHGG 770 VIH G IK++ E A V + IGG + Q+ ++EM+E+PL +P LF A GV P G Sbjct: 235 VIHPFGSVIKKDSE--AKKGVSFQSIGGLKTQIQAVREMIEMPLTNPELFTAYGVPPPRG 292 Query: 771 ILMYGAAGTGKTLIA 815 IL+YG +GTGKT+IA Sbjct: 293 ILLYGPSGTGKTMIA 307 Score = 60.5 bits (140), Expect = 2e-09 Identities = 27/55 (49%), Positives = 36/55 (65%) Frame = +3 Query: 651 VGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPHGGILMYGAAGTGKTLIA 815 V + D+GG ++KE VE PL+HP F+ +G++P GILMYG G KTLIA Sbjct: 534 VHWSDVGGNEMIKRKLKEAVEWPLKHPEAFQRLGIRPPRGILMYGPPGCSKTLIA 588 >SB_33584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 455 Score = 74.5 bits (175), Expect = 1e-13 Identities = 34/75 (45%), Positives = 48/75 (64%) Frame = +3 Query: 591 VIHCDGEPIKREEEEEALNAVGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPHGG 770 V+ D +P+ + E Y DIGG Q+ +IKE VELPL HP L++ +G+KP G Sbjct: 357 VLSDDADPMVTVMKLEKAPQESYADIGGLDTQIQEIKESVELPLTHPELYEEMGIKPPKG 416 Query: 771 ILMYGAAGTGKTLIA 815 +++YG GTGKTL+A Sbjct: 417 VILYGQPGTGKTLLA 431 >SB_3919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 442 Score = 70.9 bits (166), Expect = 1e-12 Identities = 28/53 (52%), Positives = 42/53 (79%) Frame = +3 Query: 657 YDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPHGGILMYGAAGTGKTLIA 815 Y+ +GG KQ+ +IKE++ELP++HP LF+A+G+ G+L+YG GTGKTL+A Sbjct: 176 YEMVGGLDKQIKEIKEVIELPVKHPELFEALGIDQPKGVLLYGPPGTGKTLLA 228 >SB_9909| Best HMM Match : AAA (HMM E-Value=0) Length = 400 Score = 69.3 bits (162), Expect = 4e-12 Identities = 28/55 (50%), Positives = 41/55 (74%) Frame = +3 Query: 651 VGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPHGGILMYGAAGTGKTLIA 815 V Y DIGGC++Q+ +++E+VE PL HP F +G++P G+L++G GTGKTL A Sbjct: 81 VTYSDIGGCKEQIDKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCA 135 >SB_33442| Best HMM Match : AAA (HMM E-Value=0) Length = 369 Score = 62.1 bits (144), Expect = 5e-10 Identities = 31/61 (50%), Positives = 40/61 (65%) Frame = +3 Query: 633 EEALNAVGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPHGGILMYGAAGTGKTLI 812 EE N V Y +IGG Q +I+E VELPL H L+K IG+ P G+L+YG G GKT++ Sbjct: 156 EEKPN-VSYAEIGGMDIQKQEIREAVELPLTHFELYKQIGIDPPRGVLLYGPPGCGKTML 214 Query: 813 A 815 A Sbjct: 215 A 215 >SB_48561| Best HMM Match : AAA (HMM E-Value=0) Length = 2021 Score = 58.4 bits (135), Expect = 7e-09 Identities = 24/55 (43%), Positives = 35/55 (63%) Frame = +3 Query: 651 VGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPHGGILMYGAAGTGKTLIA 815 V +D +GG KQ+ +KEM+ PL +P +F + P G+L +G GTGKTL+A Sbjct: 881 VKFDSVGGLNKQIQALKEMILFPLVYPEVFDKFKITPPRGVLFFGPPGTGKTLVA 935 >SB_35973| Best HMM Match : zf-CCHC (HMM E-Value=0.0026) Length = 779 Score = 56.0 bits (129), Expect = 4e-08 Identities = 21/62 (33%), Positives = 38/62 (61%) Frame = +3 Query: 609 EPIKREEEEEALNAVGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPHGGILMYGA 788 +P+ E + Y D+GG +Q+ +++E++ELPL +P LF+ +G+ P G L++G Sbjct: 118 DPLVYNMSHEDPGNISYSDVGGLSEQIRELREVIELPLTNPELFQRVGIAPPKGCLLFGP 177 Query: 789 AG 794 G Sbjct: 178 PG 179 >SB_49367| Best HMM Match : AAA (HMM E-Value=0) Length = 976 Score = 51.6 bits (118), Expect = 8e-07 Identities = 23/57 (40%), Positives = 37/57 (64%) Frame = +3 Query: 645 NAVGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPHGGILMYGAAGTGKTLIA 815 ++V + DIGGC L Q+ +++ + + HP +F +GV P G L++G G GKTL+A Sbjct: 672 SSVKFADIGGCSNTLEQVGKLL-VHMCHPEVFTTLGVTPTTGFLLHGPPGCGKTLLA 727 >SB_40956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1086 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/55 (43%), Positives = 36/55 (65%) Frame = +3 Query: 651 VGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPHGGILMYGAAGTGKTLIA 815 + + D+GG +I + ++LPL HP LF A G++ G+L+YG GTGKTL+A Sbjct: 809 ISWKDVGGLDSVKEEILDTIQLPLLHPELF-AAGLR-RSGVLLYGPPGTGKTLMA 861 >SB_37200| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 908 Score = 45.2 bits (102), Expect = 7e-05 Identities = 19/49 (38%), Positives = 29/49 (59%) Frame = +3 Query: 666 IGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPHGGILMYGAAGTGKTLI 812 + G + +KE+V+ PL +P F +G+ GIL+ GA G GKTL+ Sbjct: 213 LSGLDDSIKMLKELVQFPLYYPESFSHLGINGPKGILLVGAPGVGKTLL 261 Score = 45.2 bits (102), Expect = 7e-05 Identities = 19/57 (33%), Positives = 31/57 (54%) Frame = +3 Query: 642 LNAVGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPHGGILMYGAAGTGKTLI 812 L +DD+GG +++ +E PL HP F +G++ G+L+YG G KT + Sbjct: 478 LQPTRWDDVGGLEGVKQALRQAIEWPLLHPEAFARMGLRRPRGVLLYGPPGCCKTTL 534 >SB_19460| Best HMM Match : AAA (HMM E-Value=0) Length = 340 Score = 45.2 bits (102), Expect = 7e-05 Identities = 19/57 (33%), Positives = 31/57 (54%) Frame = +3 Query: 642 LNAVGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPHGGILMYGAAGTGKTLI 812 L +DD+GG +++ +E PL HP F +G++ G+L+YG G KT + Sbjct: 7 LQPTRWDDVGGLEGVKQALRQAIEWPLLHPEAFARMGLRRPRGVLLYGPPGCCKTTL 63 >SB_30385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 45.2 bits (102), Expect = 7e-05 Identities = 19/49 (38%), Positives = 29/49 (59%) Frame = +3 Query: 666 IGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPHGGILMYGAAGTGKTLI 812 + G + +KE+V+ PL +P F +G+ GIL+ GA G GKTL+ Sbjct: 43 LSGLDDSIKMLKELVQFPLYYPESFSHLGINGPKGILLVGAPGVGKTLL 91 >SB_55690| Best HMM Match : AAA (HMM E-Value=0) Length = 1031 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/55 (34%), Positives = 33/55 (60%) Frame = +3 Query: 651 VGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPHGGILMYGAAGTGKTLIA 815 +G++++GG ++E + P + LF ++ GG+L+YG GTGKTL+A Sbjct: 664 LGWENVGGLGPVKGVLQETLLWPSKFAGLFAKCPLRLRGGLLLYGPPGTGKTLLA 718 >SB_35704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 256 Score = 41.9 bits (94), Expect = 6e-04 Identities = 20/41 (48%), Positives = 30/41 (73%) Frame = +3 Query: 693 QIKEMVELPLRHPSLFKAIGVKPHGGILMYGAAGTGKTLIA 815 +++E+VE LR+P FK +G K G+L+ G+ GTGKTL+A Sbjct: 142 ELQEVVEF-LRNPEKFKRLGGKLPTGVLLIGSPGTGKTLLA 181 >SB_56202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 518 Score = 40.7 bits (91), Expect = 0.001 Identities = 25/69 (36%), Positives = 39/69 (56%) Frame = +3 Query: 609 EPIKREEEEEALNAVGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPHGGILMYGA 788 E ++R+ ++ N V + DI + ++E V LPL P F+ I +P G+LM G Sbjct: 234 EALERDILQKNPN-VHWADIADLHEAKKLLEEAVVLPLLMPDYFQGIR-RPWRGVLMVGP 291 Query: 789 AGTGKTLIA 815 GTGKT++A Sbjct: 292 PGTGKTMLA 300 >SB_7424| Best HMM Match : AAA (HMM E-Value=0) Length = 294 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/51 (37%), Positives = 29/51 (56%) Frame = +3 Query: 663 DIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPHGGILMYGAAGTGKTLIA 815 D+ GC + +I E V L++P + +G K G ++ G GTGKTL+A Sbjct: 49 DVAGCEEAKLEIMEFVNF-LKNPQQYHELGAKIPKGAILSGPPGTGKTLLA 98 >SB_33907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/33 (48%), Positives = 22/33 (66%) Frame = +3 Query: 717 PLRHPSLFKAIGVKPHGGILMYGAAGTGKTLIA 815 P++HP F A+G+ GIL+ G G GKTL+A Sbjct: 2 PVQHPEEFSALGLTHPPGILLAGPPGCGKTLLA 34 >SB_17703| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 611 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/33 (48%), Positives = 22/33 (66%) Frame = +3 Query: 717 PLRHPSLFKAIGVKPHGGILMYGAAGTGKTLIA 815 P++HP F A+G+ GIL+ G G GKTL+A Sbjct: 2 PVQHPEEFSALGLTHPPGILLAGPPGCGKTLLA 34 >SB_3115| Best HMM Match : AAA (HMM E-Value=0) Length = 913 Score = 35.1 bits (77), Expect = 0.072 Identities = 17/53 (32%), Positives = 29/53 (54%) Frame = +3 Query: 657 YDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPHGGILMYGAAGTGKTLIA 815 + D+ G ++ ++ E V+ L+ + +G K G L+ G GTGKTL+A Sbjct: 124 FKDVAGMQEAKMEVMEFVDY-LKSAGRYTQLGAKIPKGALLVGPPGTGKTLLA 175 >SB_28977| Best HMM Match : AAA (HMM E-Value=0) Length = 442 Score = 33.5 bits (73), Expect = 0.22 Identities = 19/49 (38%), Positives = 24/49 (48%) Frame = +3 Query: 651 VGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPHGGILMYGAAGT 797 V + DI G +KE V LP++ P LF P GIL+YG T Sbjct: 94 VKWSDIAGLESAKEALKEAVILPIKFPHLFTGKRT-PWRGILLYGVTFT 141 >SB_732| Best HMM Match : AAA (HMM E-Value=0) Length = 388 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = +3 Query: 747 IGVKPHGGILMYGAAGTGKTLIA 815 +G+K GIL++G GTGKTL+A Sbjct: 177 MGLKHVKGILLFGPPGTGKTLMA 199 >SB_32255| Best HMM Match : Spectrin (HMM E-Value=0.23) Length = 172 Score = 28.3 bits (60), Expect = 8.3 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +3 Query: 618 KREEEEEALNAVGYDDIGGCRKQLAQIKEMVE 713 KREEE E L + + C+K+L ++E++E Sbjct: 63 KREEELELLLETRTEKLSECKKRLLDLEEIIE 94 >SB_22720| Best HMM Match : KID (HMM E-Value=0.0014) Length = 847 Score = 28.3 bits (60), Expect = 8.3 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +3 Query: 618 KREEEEEALNAVGYDDIGGCRKQLAQIKEMVE 713 KREEE E L + + C+K+L ++E++E Sbjct: 664 KREEELELLLETRTEKLSECKKRLLDLEEIIE 695 >SB_38103| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 741 Score = 28.3 bits (60), Expect = 8.3 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = +3 Query: 603 DGEPIKREEEEEALNAVGYDDIGGCRKQLAQIKEM 707 D + + EEEEE +G+D+ G ++L +I+E+ Sbjct: 255 DDDETEDEEEEEEQPVMGWDEYGTSPQRLQRIREL 289 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,613,606 Number of Sequences: 59808 Number of extensions: 585370 Number of successful extensions: 1633 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 1492 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1630 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2395401800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -