BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30596.Seq (698 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 111 5e-25 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 98 5e-21 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 5e-21 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 93 3e-19 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 93 3e-19 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 87 2e-17 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 2e-17 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 5e-15 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_35685| Best HMM Match : Ribosomal_S8 (HMM E-Value=0.08) 76 3e-14 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 4e-14 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 6e-14 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 3e-12 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 4e-12 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 63 2e-10 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 63 2e-10 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 63 2e-10 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 9e-09 SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 8e-08 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 8e-08 SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 54 1e-07 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 52 3e-07 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 52 4e-07 SB_57792| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_28860| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) 49 4e-06 SB_54086| Best HMM Match : Phage_integrase (HMM E-Value=0.68) 48 6e-06 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 48 6e-06 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_13077| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) 45 5e-05 SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_29284| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 44 9e-05 SB_7086| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_1324| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 44 1e-04 SB_58985| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_38217| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_16590| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_9986| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_13218| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_54335| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_26800| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_132| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_51296| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_36241| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 42 5e-04 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 42 5e-04 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 42 5e-04 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 42 5e-04 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 42 5e-04 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 42 5e-04 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 42 5e-04 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 42 5e-04 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 42 5e-04 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 42 5e-04 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 42 5e-04 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 42 5e-04 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 42 5e-04 SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 42 5e-04 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 42 5e-04 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 42 5e-04 SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) 42 5e-04 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 42 5e-04 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 42 5e-04 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 42 5e-04 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 42 5e-04 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_48116| Best HMM Match : Flu_NS2 (HMM E-Value=9.1) 42 5e-04 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 42 5e-04 SB_48066| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 42 5e-04 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_47314| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 42 5e-04 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 42 5e-04 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 42 5e-04 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 42 5e-04 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 42 5e-04 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 42 5e-04 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 42 5e-04 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 42 5e-04 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 42 5e-04 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 42 5e-04 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_43709| Best HMM Match : NodZ (HMM E-Value=0.42) 42 5e-04 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 42 5e-04 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 42 5e-04 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 42 5e-04 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 42 5e-04 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 42 5e-04 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 42 5e-04 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 42 5e-04 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 42 5e-04 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 42 5e-04 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_38216| Best HMM Match : APOBEC_C (HMM E-Value=7.3) 42 5e-04 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 42 5e-04 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 42 5e-04 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_37438| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 42 5e-04 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 42 5e-04 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_36405| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_36096| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 42 5e-04 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 42 5e-04 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 42 5e-04 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 42 5e-04 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_33950| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 42 5e-04 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_33515| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 42 5e-04 SB_32525| Best HMM Match : DED (HMM E-Value=0.81) 42 5e-04 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 42 5e-04 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_32290| Best HMM Match : BTP (HMM E-Value=8.7) 42 5e-04 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 42 5e-04 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 42 5e-04 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_31585| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 42 5e-04 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 42 5e-04 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 111 bits (267), Expect = 5e-25 Identities = 50/59 (84%), Positives = 51/59 (86%) Frame = -1 Query: 698 CATVGXGDXVRASXAITPAGERXMCCKAIKLGNAQGFPSHDVVKRRPVNCNTTHYRANW 522 CATVG GD AITPAGER MCCKAIKLGNA+GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 2 CATVGKGDRC-GLFAITPAGERGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 98.3 bits (234), Expect = 5e-21 Identities = 42/45 (93%), Positives = 42/45 (93%) Frame = -1 Query: 656 AITPAGERXMCCKAIKLGNAQGFPSHDVVKRRPVNCNTTHYRANW 522 AITPAGER MCCKAIKLGNA FPSHDVVKRRPVNCNTTHYRANW Sbjct: 9 AITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 53 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 98.3 bits (234), Expect = 5e-21 Identities = 42/45 (93%), Positives = 42/45 (93%) Frame = -1 Query: 656 AITPAGERXMCCKAIKLGNAQGFPSHDVVKRRPVNCNTTHYRANW 522 AITPAGER MCCKAIKLGNA FPSHDVVKRRPVNCNTTHYRANW Sbjct: 23 AITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 67 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 92.7 bits (220), Expect = 3e-19 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -1 Query: 656 AITPAGERXMCCKAIKLGNAQGFPSHDVVKRRPVNCNTTHYRANW 522 AITPAGER MCCK+IKL +A FPSHDVVKRRPVNCNTTHYRANW Sbjct: 17 AITPAGERGMCCKSIKLAHASVFPSHDVVKRRPVNCNTTHYRANW 61 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 92.7 bits (220), Expect = 3e-19 Identities = 40/44 (90%), Positives = 41/44 (93%) Frame = -1 Query: 656 AITPAGERXMCCKAIKLGNAQGFPSHDVVKRRPVNCNTTHYRAN 525 AITPAGER MCCKAIKLGNA+GFPSHD KRRPVNCNTTHYRAN Sbjct: 54 AITPAGERGMCCKAIKLGNARGFPSHDGEKRRPVNCNTTHYRAN 97 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 86.6 bits (205), Expect = 2e-17 Identities = 38/45 (84%), Positives = 39/45 (86%) Frame = +3 Query: 522 PIRPIVSRITIHWPSFYNVVTGKTLGVTQLNRLAAHXPFASWGNS 656 PIRPIVSRITIHWP+FYN TGKTL TQLNRLAAH PFASW NS Sbjct: 39 PIRPIVSRITIHWPAFYNAPTGKTLAYTQLNRLAAHPPFASWRNS 83 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 86.2 bits (204), Expect = 2e-17 Identities = 39/45 (86%), Positives = 39/45 (86%) Frame = -1 Query: 656 AITPAGERXMCCKAIKLGNAQGFPSHDVVKRRPVNCNTTHYRANW 522 AITPAGER MCCKAIKL FPSHDVVKRRPVNCNTTHYRANW Sbjct: 1856 AITPAGERGMCCKAIKLVTPV-FPSHDVVKRRPVNCNTTHYRANW 1899 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 81.4 bits (192), Expect = 6e-16 Identities = 36/39 (92%), Positives = 36/39 (92%) Frame = +3 Query: 540 SRITIHWPSFYNVVTGKTLGVTQLNRLAAHXPFASWGNS 656 SRITIHWPSFYNVVTGKTL VTQLNRLAAH PFASW NS Sbjct: 2 SRITIHWPSFYNVVTGKTLSVTQLNRLAAHPPFASWRNS 40 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 79.8 bits (188), Expect = 2e-15 Identities = 35/39 (89%), Positives = 35/39 (89%) Frame = +3 Query: 540 SRITIHWPSFYNVVTGKTLGVTQLNRLAAHXPFASWGNS 656 SRITIHWPSFYNVVTGK GVTQLNRLAAH PFASW NS Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRNS 40 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 79.8 bits (188), Expect = 2e-15 Identities = 35/39 (89%), Positives = 35/39 (89%) Frame = +3 Query: 540 SRITIHWPSFYNVVTGKTLGVTQLNRLAAHXPFASWGNS 656 SRITIHWPSFYNVVTGK GVTQLNRLAAH PFASW NS Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRNS 40 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 79.0 bits (186), Expect = 3e-15 Identities = 35/39 (89%), Positives = 35/39 (89%) Frame = +3 Query: 540 SRITIHWPSFYNVVTGKTLGVTQLNRLAAHXPFASWGNS 656 SRITIHWPSFYNVVTGK GVTQLNRLAAH PFASW NS Sbjct: 2 SRITIHWPSFYNVVTGKNPGVTQLNRLAAHPPFASWRNS 40 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 78.6 bits (185), Expect = 5e-15 Identities = 35/46 (76%), Positives = 38/46 (82%), Gaps = 1/46 (2%) Frame = -1 Query: 656 AITPAGERXMCCKA-IKLGNAQGFPSHDVVKRRPVNCNTTHYRANW 522 AITPAGE+ + +KLG QGFPSHDVVKRRPVNCNTTHYRANW Sbjct: 57 AITPAGEKGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRANW 102 Score = 31.1 bits (67), Expect = 0.90 Identities = 17/29 (58%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = -3 Query: 672 GAGLXRYYPSWRKGDVLQGD-*VG*RPGF 589 GAGL P+ KGDVLQGD +G R GF Sbjct: 52 GAGLFAITPAGEKGDVLQGDLKLGKRQGF 80 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 78.2 bits (184), Expect = 6e-15 Identities = 34/38 (89%), Positives = 34/38 (89%) Frame = -1 Query: 638 ERXMCCKAIKLGNAQGFPSHDVVKRRPVNCNTTHYRAN 525 ER MCCKAIKLGNA F SHDVVKRRPVNCNTTHYRAN Sbjct: 3 ERGMCCKAIKLGNASVFRSHDVVKRRPVNCNTTHYRAN 40 >SB_35685| Best HMM Match : Ribosomal_S8 (HMM E-Value=0.08) Length = 120 Score = 75.8 bits (178), Expect = 3e-14 Identities = 38/44 (86%), Positives = 40/44 (90%) Frame = -2 Query: 466 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMKH 335 MVR+NVL+DAL SI NAEKRGKRQV IRP SKVIVKFLTVMMKH Sbjct: 1 MVRVNVLNDALVSICNAEKRGKRQVQIRPSSKVIVKFLTVMMKH 44 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 75.4 bits (177), Expect = 4e-14 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = +3 Query: 540 SRITIHWPSFYNVVTGKTLGVTQLNRLAAHXPFASWGNSXR 662 SRITIHWPSFYNV+ KT GVTQLNRLAAH PFASW NS + Sbjct: 2 SRITIHWPSFYNVMLAKTPGVTQLNRLAAHPPFASWRNSEK 42 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 74.9 bits (176), Expect = 6e-14 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = +3 Query: 555 HWPSFYNVVTGKTLGVTQLNRLAAHXPFASWGNS 656 HWPSFYNVVTGKTLGVTQLNRLAAH PFASW NS Sbjct: 5 HWPSFYNVVTGKTLGVTQLNRLAAHPPFASWRNS 38 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 71.3 bits (167), Expect = 7e-13 Identities = 32/39 (82%), Positives = 33/39 (84%) Frame = +3 Query: 540 SRITIHWPSFYNVVTGKTLGVTQLNRLAAHXPFASWGNS 656 SRITIHWPSFYNVV + GVTQLNRLAAH PFASW NS Sbjct: 2 SRITIHWPSFYNVVHWENPGVTQLNRLAAHPPFASWRNS 40 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 69.7 bits (163), Expect = 2e-12 Identities = 31/39 (79%), Positives = 32/39 (82%) Frame = +3 Query: 540 SRITIHWPSFYNVVTGKTLGVTQLNRLAAHXPFASWGNS 656 SRITIHWPSFYNVVTGKTL + L LAAH PFASW NS Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALAAHPPFASWRNS 40 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 69.3 bits (162), Expect = 3e-12 Identities = 32/44 (72%), Positives = 34/44 (77%) Frame = +3 Query: 525 IRPIVSRITIHWPSFYNVVTGKTLGVTQLNRLAAHXPFASWGNS 656 IRPIVSRITIHWPSFY + GV QLNRLAAH PFASW +S Sbjct: 18 IRPIVSRITIHWPSFYKRRDWENPGVNQLNRLAAHPPFASWRSS 61 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 68.9 bits (161), Expect = 4e-12 Identities = 30/52 (57%), Positives = 37/52 (71%) Frame = -1 Query: 677 DXVRASXAITPAGERXMCCKAIKLGNAQGFPSHDVVKRRPVNCNTTHYRANW 522 + V A TP+G++ M ++ +A FPSHDVVKRRPVNCNTTHYRANW Sbjct: 8 ETVAVVLATTPSGDKSMYSESNNKSHAIVFPSHDVVKRRPVNCNTTHYRANW 59 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 65.7 bits (153), Expect = 3e-11 Identities = 29/39 (74%), Positives = 30/39 (76%) Frame = +3 Query: 540 SRITIHWPSFYNVVTGKTLGVTQLNRLAAHXPFASWGNS 656 SRITIHWPSFYNVVTGKTL + L L H PFASW NS Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQLHPPFASWRNS 40 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 62.9 bits (146), Expect = 2e-10 Identities = 32/53 (60%), Positives = 36/53 (67%) Frame = -1 Query: 680 GDXVRASXAITPAGERXMCCKAIKLGNAQGFPSHDVVKRRPVNCNTTHYRANW 522 G VRAS + + C A +L + GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 600 GRSVRASSLLRQLAKGG--CAARRL--SWGFPSHDVVKRRPVNCNTTHYRANW 648 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 62.9 bits (146), Expect = 2e-10 Identities = 32/53 (60%), Positives = 36/53 (67%) Frame = -1 Query: 680 GDXVRASXAITPAGERXMCCKAIKLGNAQGFPSHDVVKRRPVNCNTTHYRANW 522 G VRAS + + C A +L + GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 43 GRSVRASSLLRQLAKGG--CAARRL--SWGFPSHDVVKRRPVNCNTTHYRANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 62.9 bits (146), Expect = 2e-10 Identities = 32/53 (60%), Positives = 36/53 (67%) Frame = -1 Query: 680 GDXVRASXAITPAGERXMCCKAIKLGNAQGFPSHDVVKRRPVNCNTTHYRANW 522 G VRAS + + C A +L + GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 43 GRSVRASSLLRQLAKGG--CAARRL--SWGFPSHDVVKRRPVNCNTTHYRANW 91 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 62.5 bits (145), Expect = 3e-10 Identities = 32/54 (59%), Positives = 35/54 (64%), Gaps = 1/54 (1%) Frame = -1 Query: 680 GDXVRASXAITPAGERXMCCKAIKLG-NAQGFPSHDVVKRRPVNCNTTHYRANW 522 G VRAS + + C A +L GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 29 GRSVRASSLLRQLAKGG--CAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 62.1 bits (144), Expect = 4e-10 Identities = 30/39 (76%), Positives = 30/39 (76%) Frame = -3 Query: 666 GLXRYYPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 550 G RYY SWRKGDVLQG PGFSQSRRCKTTASEL Sbjct: 12 GPLRYYASWRKGDVLQGRLSWVTPGFSQSRRCKTTASEL 50 Score = 33.9 bits (74), Expect = 0.13 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = -2 Query: 688 LGXAXRCGPLXLLPQLAKGXCAARRLSWVTP 596 +G RCGPL KG RLSWVTP Sbjct: 5 VGKGDRCGPLRYYASWRKGDVLQGRLSWVTP 35 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 61.7 bits (143), Expect = 6e-10 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -1 Query: 593 GFPSHDVVKRRPVNCNTTHYRANW 522 GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 1 GFPSHDVVKRRPVNCNTTHYRANW 24 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 61.7 bits (143), Expect = 6e-10 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -1 Query: 593 GFPSHDVVKRRPVNCNTTHYRANW 522 GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 57 GFPSHDVVKRRPVNCNTTHYRANW 80 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 60.9 bits (141), Expect = 1e-09 Identities = 28/39 (71%), Positives = 29/39 (74%) Frame = +3 Query: 540 SRITIHWPSFYNVVTGKTLGVTQLNRLAAHXPFASWGNS 656 SRITIHWPSFYNVVTGKTL + L L PFASW NS Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPPFASWRNS 40 Score = 33.1 bits (72), Expect = 0.22 Identities = 18/32 (56%), Positives = 20/32 (62%) Frame = +1 Query: 586 GKPWALPNLIALQHIXLSPAGVIAXEARTXSP 681 GK ALPNLIALQHI + + EART P Sbjct: 17 GKTLALPNLIALQHIPPFASWRNSEEARTDRP 48 >SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 58.8 bits (136), Expect = 4e-09 Identities = 29/39 (74%), Positives = 29/39 (74%) Frame = -3 Query: 666 GLXRYYPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 550 G RYY SWRKGDVLQ PGFSQSRRCKTTASEL Sbjct: 12 GPLRYYASWRKGDVLQRRLSWVTPGFSQSRRCKTTASEL 50 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/34 (58%), Positives = 20/34 (58%) Frame = -2 Query: 697 AQLLGXAXRCGPLXLLPQLAKGXCAARRLSWVTP 596 AQLLG RCGPL KG RRLSWVTP Sbjct: 2 AQLLGKGDRCGPLRYYASWRKGDVLQRRLSWVTP 35 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 58.0 bits (134), Expect = 7e-09 Identities = 27/40 (67%), Positives = 29/40 (72%) Frame = +3 Query: 537 VSRITIHWPSFYNVVTGKTLGVTQLNRLAAHXPFASWGNS 656 +SRITIHWPS + GVTQLNRLAAH PFASW NS Sbjct: 277 LSRITIHWPSVLQRRDWENPGVTQLNRLAAHPPFASWRNS 316 >SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 57.6 bits (133), Expect = 9e-09 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = +3 Query: 570 YNVVTGKTLGVTQLNRLAAHXPFASWGNS 656 YNVVTGKT GVTQLNRLAAH PFASW NS Sbjct: 12 YNVVTGKTPGVTQLNRLAAHPPFASWRNS 40 >SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 56.8 bits (131), Expect = 2e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 666 GLXRYYPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 550 G RYY SWRKGD G PGFSQSRRCKTTASEL Sbjct: 41 GPLRYYASWRKGDATASRLSGATPGFSQSRRCKTTASEL 79 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -2 Query: 688 LGXAXRCGPLXLLPQLAKGXCAARRLSWVTP 596 +G RCGPL KG A RLS TP Sbjct: 34 VGKGDRCGPLRYYASWRKGDATASRLSGATP 64 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 54.8 bits (126), Expect = 6e-08 Identities = 26/42 (61%), Positives = 30/42 (71%) Frame = +3 Query: 525 IRPIVSRITIHWPSFYNVVTGKTLGVTQLNRLAAHXPFASWG 650 +RP+VSRITIHW SFYNVVTGKTL + L L H P + G Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIAL-QHIPLSPAG 73 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/32 (81%), Positives = 26/32 (81%) Frame = +1 Query: 586 GKPWALPNLIALQHIXLSPAGVIAXEARTXSP 681 GK ALPNLIALQHI LSPAGVIA EART P Sbjct: 53 GKTLALPNLIALQHIPLSPAGVIAEEARTDRP 84 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 54.4 bits (125), Expect = 8e-08 Identities = 27/48 (56%), Positives = 30/48 (62%) Frame = +3 Query: 555 HWPSFYNVVTGKTLGVTQLNRLAAHXPFASWGNSXRGPHRIAXPNSCA 698 HWPSFYNVVTGKTL + L L H P + G + P IA PNSCA Sbjct: 62 HWPSFYNVVTGKTLALPNLIAL-QHIPLSPAGVIAKRPAPIALPNSCA 108 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = +1 Query: 586 GKPWALPNLIALQHIXLSPAGVIA 657 GK ALPNLIALQHI LSPAGVIA Sbjct: 72 GKTLALPNLIALQHIPLSPAGVIA 95 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 54.4 bits (125), Expect = 8e-08 Identities = 27/48 (56%), Positives = 30/48 (62%) Frame = +3 Query: 555 HWPSFYNVVTGKTLGVTQLNRLAAHXPFASWGNSXRGPHRIAXPNSCA 698 HWPSFYNVVTGKTL + L L H P + G + P IA PNSCA Sbjct: 57 HWPSFYNVVTGKTLALPNLIAL-QHIPLSPAGVIAKRPAPIALPNSCA 103 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = +1 Query: 586 GKPWALPNLIALQHIXLSPAGVIA 657 GK ALPNLIALQHI LSPAGVIA Sbjct: 67 GKTLALPNLIALQHIPLSPAGVIA 90 >SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 54.0 bits (124), Expect = 1e-07 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = -1 Query: 629 MCCKAIKLGNAQGFPSHDVVKRRPV 555 MCCKAIKLGNA+ FPSHDVVKRRPV Sbjct: 1 MCCKAIKLGNARVFPSHDVVKRRPV 25 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 54.0 bits (124), Expect = 1e-07 Identities = 28/49 (57%), Positives = 31/49 (63%) Frame = +3 Query: 540 SRITIHWPSFYNVVTGKTLGVTQLNRLAAHXPFASWGNSXRGPHRIAXP 686 SRITIHWPSFYNVVTGKTL + L L H P + G + P IA P Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIAL-QHIPLSPAGVIAKRPAPIALP 49 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 52.4 bits (120), Expect = 3e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 581 HDVVKRRPVNCNTTHYRANW 522 HDVVKRRPVNCNTTHYRANW Sbjct: 2 HDVVKRRPVNCNTTHYRANW 21 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 52.4 bits (120), Expect = 3e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 581 HDVVKRRPVNCNTTHYRANW 522 HDVVKRRPVNCNTTHYRANW Sbjct: 2 HDVVKRRPVNCNTTHYRANW 21 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 52.4 bits (120), Expect = 3e-07 Identities = 25/40 (62%), Positives = 28/40 (70%) Frame = +3 Query: 531 PIVSRITIHWPSFYNVVTGKTLGVTQLNRLAAHXPFASWG 650 P +SRITIHWPSFYNVVTGKTL + L L H P + G Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALPNLIAL-QHIPLSPAG 115 Score = 46.8 bits (106), Expect = 2e-05 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = +1 Query: 586 GKPWALPNLIALQHIXLSPAGVIAXEARTXSP 681 GK ALPNLIALQHI LSPAG+ EART P Sbjct: 95 GKTLALPNLIALQHIPLSPAGLHREEARTDRP 126 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 52.0 bits (119), Expect = 4e-07 Identities = 28/45 (62%), Positives = 28/45 (62%) Frame = +3 Query: 522 PIRPIVSRITIHWPSFYNVVTGKTLGVTQLNRLAAHXPFASWGNS 656 PIRPIVS ITIHWPSFYN VT AH PFASW NS Sbjct: 41 PIRPIVSHITIHWPSFYNGVT-------------AHPPFASWRNS 72 >SB_57792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 50.8 bits (116), Expect = 1e-06 Identities = 23/28 (82%), Positives = 24/28 (85%) Frame = +3 Query: 573 NVVTGKTLGVTQLNRLAAHXPFASWGNS 656 N VTGKT GVTQLNRLAAH PFA+W NS Sbjct: 8 NDVTGKTPGVTQLNRLAAHPPFANWRNS 35 >SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 29 Score = 50.0 bits (114), Expect = 2e-06 Identities = 22/28 (78%), Positives = 25/28 (89%), Gaps = 1/28 (3%) Frame = -1 Query: 254 CGVISPRFDVPINDIERW-TNLLPSRQF 174 CGVISPRFDV + DIE+W +NLLPSRQF Sbjct: 1 CGVISPRFDVGVRDIEQWASNLLPSRQF 28 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/37 (64%), Positives = 26/37 (70%) Frame = +3 Query: 540 SRITIHWPSFYNVVTGKTLGVTQLNRLAAHXPFASWG 650 SRITIHWPSFYNVVTGKTL + L L H P + G Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIAL-QHIPLSPAG 37 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/32 (75%), Positives = 25/32 (78%) Frame = +1 Query: 586 GKPWALPNLIALQHIXLSPAGVIAXEARTXSP 681 GK ALPNLIALQHI LSPAGV + EART P Sbjct: 17 GKTLALPNLIALQHIPLSPAGVNSEEARTDRP 48 >SB_28860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 49.6 bits (113), Expect = 2e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = -1 Query: 629 MCCKAIKLGNAQGFPSHDVVKRRPV 555 MC KAIKLGNA FPSHDVVKRRPV Sbjct: 1 MCSKAIKLGNASVFPSHDVVKRRPV 25 >SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 49.6 bits (113), Expect = 2e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 666 GLXRYYPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 550 G RYY SWRKG PGFSQSRRCKTTASEL Sbjct: 72 GPLRYYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 110 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/33 (57%), Positives = 20/33 (60%) Frame = -2 Query: 694 QLLGXAXRCGPLXLLPQLAKGXCAARRLSWVTP 596 Q+ RCGPL KG CAARRLSWVTP Sbjct: 63 QVTQQGDRCGPLRYYASWRKGGCAARRLSWVTP 95 >SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) Length = 107 Score = 48.8 bits (111), Expect = 4e-06 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -1 Query: 656 AITPAGERXMCCKAIKLGNAQGFP 585 AITPAGER MCCKAIKLGNA+ FP Sbjct: 30 AITPAGERGMCCKAIKLGNARVFP 53 Score = 30.3 bits (65), Expect = 1.6 Identities = 17/41 (41%), Positives = 21/41 (51%) Frame = -2 Query: 697 AQLLGXAXRCGPLXLLPQLAKGXCAARRLSWVTPRVFPVTT 575 AQLLG A G + P +G C + + RVFPVTT Sbjct: 17 AQLLGRAIGAGLFAITPAGERGMC-CKAIKLGNARVFPVTT 56 >SB_54086| Best HMM Match : Phage_integrase (HMM E-Value=0.68) Length = 282 Score = 48.4 bits (110), Expect = 6e-06 Identities = 21/33 (63%), Positives = 21/33 (63%) Frame = +3 Query: 558 WPSFYNVVTGKTLGVTQLNRLAAHXPFASWGNS 656 WPS YN GVTQLNRL AH PF SW NS Sbjct: 218 WPSIYNDRDWNNSGVTQLNRLVAHLPFVSWRNS 250 >SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) Length = 532 Score = 48.4 bits (110), Expect = 6e-06 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNSXRGPHRIAXP 686 GVTQLNRLAAH PFASW NS R PHR P Sbjct: 357 GVTQLNRLAAHPPFASWRNSER-PHRSPFP 385 Score = 28.3 bits (60), Expect = 6.3 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 569 LQRRDWENPG 598 LQRRDWENPG Sbjct: 348 LQRRDWENPG 357 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 48.0 bits (109), Expect = 7e-06 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = +3 Query: 540 SRITIHWPSFYNVVTGKTLGVTQLNRLAAHXP 635 SRITIHWPSFYNVVTGKTL + L L H P Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLFDL-RHIP 32 Score = 31.9 bits (69), Expect = 0.51 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = +1 Query: 586 GKPWALPNLIALQHIXLSPAGVIAXEARTXSP 681 GK ALPNL L+HI L + + EART P Sbjct: 17 GKTLALPNLFDLRHIPLYASCTTSEEARTDRP 48 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 46.4 bits (105), Expect = 2e-05 Identities = 25/40 (62%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +3 Query: 540 SRITIHWPSFYNVVTGKTLG-VTQLNRLAAHXPFASWGNS 656 SRITIHWPSFYNVVTGK G L L ASW NS Sbjct: 2 SRITIHWPSFYNVVTGKNTGREPSLFDLQYIPLVASWRNS 41 >SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 46.0 bits (104), Expect = 3e-05 Identities = 21/34 (61%), Positives = 22/34 (64%) Frame = +3 Query: 555 HWPSFYNVVTGKTLGVTQLNRLAAHXPFASWGNS 656 HWPSFYN VTGKTL + L L FASW NS Sbjct: 5 HWPSFYNDVTGKTLALPNLIALQHIPTFASWRNS 38 Score = 33.9 bits (74), Expect = 0.13 Identities = 18/32 (56%), Positives = 20/32 (62%) Frame = +1 Query: 586 GKPWALPNLIALQHIXLSPAGVIAXEARTXSP 681 GK ALPNLIALQHI + + EART P Sbjct: 15 GKTLALPNLIALQHIPTFASWRNSQEARTDRP 46 >SB_13077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/28 (71%), Positives = 20/28 (71%) Frame = -3 Query: 696 RNCWXGRXGAGLXRYYPSWRKGDVLQGD 613 RNCW G G RYY SWRKGDVLQGD Sbjct: 38 RNCWEGDR-CGPLRYYASWRKGDVLQGD 64 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 46.0 bits (104), Expect = 3e-05 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = +1 Query: 586 GKPWALPNLIALQHIXLSPAGVIAXEARTXSP 681 GK ALPNLIALQHI LSPAG + EART P Sbjct: 15 GKTLALPNLIALQHIPLSPAGRNSEEARTDRP 46 Score = 41.1 bits (92), Expect = 8e-04 Identities = 19/34 (55%), Positives = 22/34 (64%) Frame = +3 Query: 555 HWPSFYNVVTGKTLGVTQLNRLAAHXPFASWGNS 656 HWPSFYNVVTGKTL + L L H P + G + Sbjct: 5 HWPSFYNVVTGKTLALPNLIAL-QHIPLSPAGRN 37 >SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 45.6 bits (103), Expect = 4e-05 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNSXR 662 GVTQLNRLAAH PFASWGNS + Sbjct: 144 GVTQLNRLAAHPPFASWGNSEK 165 Score = 41.5 bits (93), Expect = 6e-04 Identities = 24/47 (51%), Positives = 27/47 (57%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF G ++ RPSQQLR Sbjct: 131 LAVVLQRRDWENPGVTQLNRLAAHPPFASWG-NSEKARTDRPSQQLR 176 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASWGNS Sbjct: 80 GVTQLNRLAAHPPFASWGNS 99 Score = 40.7 bits (91), Expect = 0.001 Identities = 24/47 (51%), Positives = 26/47 (55%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF G + RPSQQLR Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWG-NSEEARTDRPSQQLR 112 >SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) Length = 152 Score = 45.2 bits (102), Expect = 5e-05 Identities = 28/56 (50%), Positives = 31/56 (55%), Gaps = 7/56 (12%) Frame = +3 Query: 510 GARYPIRPIVSRITIHWPSFYNVVT-------GKTLGVTQLNRLAAHXPFASWGNS 656 G YP P SR H S+YN + + GVTQLNRLAAH PFASW NS Sbjct: 42 GLNYPFVPKSSR---HSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 94 >SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = +3 Query: 585 GKTLGVTQLNRLAAHXPFASWGNS 656 G+ GVTQLNRLAAH PFASW NS Sbjct: 38 GENTGVTQLNRLAAHPPFASWRNS 61 Score = 29.1 bits (62), Expect = 3.6 Identities = 21/47 (44%), Positives = 23/47 (48%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRD EN G + PF + RPSQQLR Sbjct: 29 LAVVLQRRDGENTGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 74 >SB_29284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = +3 Query: 585 GKTLGVTQLNRLAAHXPFASWGNS 656 G+ GVTQLNRLAAH PFASW NS Sbjct: 63 GENTGVTQLNRLAAHPPFASWRNS 86 Score = 29.1 bits (62), Expect = 3.6 Identities = 21/47 (44%), Positives = 23/47 (48%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRD EN G + PF + RPSQQLR Sbjct: 54 LAVVLQRRDGENTGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 99 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = +3 Query: 585 GKTLGVTQLNRLAAHXPFASWGNS 656 G+ GVTQLNRLAAH PFASW NS Sbjct: 704 GENTGVTQLNRLAAHPPFASWRNS 727 Score = 29.1 bits (62), Expect = 3.6 Identities = 21/47 (44%), Positives = 23/47 (48%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRD EN G + PF + RPSQQLR Sbjct: 695 LAVVLQRRDGENTGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 740 >SB_7086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 44.4 bits (100), Expect = 9e-05 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNSXR 662 GVTQLNRLAAH PFASWGN+ + Sbjct: 42 GVTQLNRLAAHPPFASWGNNEK 63 Score = 41.9 bits (94), Expect = 5e-04 Identities = 24/47 (51%), Positives = 27/47 (57%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF G ++ RPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWG-NNEKARTDRPSQQLR 74 >SB_1324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = +3 Query: 585 GKTLGVTQLNRLAAHXPFASWGNS 656 G+ GVTQLNRLAAH PFASW NS Sbjct: 75 GENTGVTQLNRLAAHPPFASWRNS 98 Score = 29.1 bits (62), Expect = 3.6 Identities = 21/47 (44%), Positives = 23/47 (48%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRD EN G + PF + RPSQQLR Sbjct: 66 LAVVLQRRDGENTGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 111 >SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) Length = 1709 Score = 44.0 bits (99), Expect = 1e-04 Identities = 23/42 (54%), Positives = 27/42 (64%), Gaps = 7/42 (16%) Frame = +3 Query: 552 IHWPSFYNVVT-------GKTLGVTQLNRLAAHXPFASWGNS 656 IH+ S+YN + + GVTQLNRLAAH PFASW NS Sbjct: 1464 IHYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 1505 >SB_58985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 44.0 bits (99), Expect = 1e-04 Identities = 30/79 (37%), Positives = 37/79 (46%), Gaps = 2/79 (2%) Frame = +3 Query: 426 IDFKASLNTFIRTMAKI*LALRSEPN*RGARY--PIRPIVSRITIHWPSFYNVVTGKTLG 599 +DF F R +KI L PN RG + P+ ++ + G Sbjct: 95 VDFDYRYTVFYRIQSKIYPPL--PPNIRGKKIGDPLESTCRHASLALAVVLQRRDWENPG 152 Query: 600 VTQLNRLAAHXPFASWGNS 656 VTQLNRLAAH PFASW NS Sbjct: 153 VTQLNRLAAHPPFASWRNS 171 >SB_38217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = +3 Query: 588 KTLGVTQLNRLAAHXPFASWGNS 656 K GVTQLNRLAAH PFASW NS Sbjct: 18 KNTGVTQLNRLAAHPPFASWRNS 40 Score = 32.7 bits (71), Expect = 0.29 Identities = 21/47 (44%), Positives = 24/47 (51%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDW+N G + PF + RPSQQLR Sbjct: 8 LAVVLQRRDWKNTGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 53 >SB_16590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = +3 Query: 585 GKTLGVTQLNRLAAHXPFASWGNS 656 G+ GVTQLNRLAAH PFASW NS Sbjct: 38 GENPGVTQLNRLAAHPPFASWRNS 61 Score = 32.3 bits (70), Expect = 0.39 Identities = 22/47 (46%), Positives = 24/47 (51%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRD ENPG + PF + RPSQQLR Sbjct: 29 LAVVLQRRDGENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 74 >SB_9986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 36 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/28 (71%), Positives = 20/28 (71%) Frame = -3 Query: 696 RNCWXGRXGAGLXRYYPSWRKGDVLQGD 613 RNC G GL RYY SWRKGDVLQGD Sbjct: 10 RNCGKGDR-CGLLRYYASWRKGDVLQGD 36 >SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PF SWGNS Sbjct: 65 GVTQLNRLAAHPPFTSWGNS 84 Score = 40.7 bits (91), Expect = 0.001 Identities = 24/47 (51%), Positives = 26/47 (55%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF G + RPSQQLR Sbjct: 52 LAVVLQRRDWENPGVTQLNRLAAHPPFTSWG-NSEEARTDRPSQQLR 97 >SB_13218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 78 GVTQLNRLAAHPPFASWSNS 97 Score = 32.7 bits (71), Expect = 0.29 Identities = 21/47 (44%), Positives = 23/47 (48%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAV LQR DWENPG + PF + RPSQQLR Sbjct: 65 LAVDLQRPDWENPGVTQLNRLAAHPPFASWS-NSEEARTDRPSQQLR 110 >SB_54335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 51 GVTQLNRLAAHPPFASWSNS 70 Score = 38.3 bits (85), Expect = 0.006 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWS-NSEEARTDRPSQQLR 83 >SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 42.7 bits (96), Expect = 3e-04 Identities = 22/45 (48%), Positives = 29/45 (64%), Gaps = 3/45 (6%) Frame = +3 Query: 531 PIVSRITIHWPSFYNVVTGKTL---GVTQLNRLAAHXPFASWGNS 656 P++ R+ ++ S V+ + GVTQLNRLAAH PFASW NS Sbjct: 50 PVMGRLESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 94 >SB_26800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/39 (53%), Positives = 22/39 (56%) Frame = +3 Query: 570 YNVVTGKTLGVTQLNRLAAHXPFASWGNSXRGPHRIAXP 686 Y+VVTGKTL V LN L FASW R PHR P Sbjct: 13 YDVVTGKTLAVPSLNALQHIPHFASWRTYPRSPHRSPFP 51 >SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 42.7 bits (96), Expect = 3e-04 Identities = 23/53 (43%), Positives = 27/53 (50%) Frame = +3 Query: 498 PN*RGARYPIRPIVSRITIHWPSFYNVVTGKTLGVTQLNRLAAHXPFASWGNS 656 PN R R P+ ++ + GVTQLNRLAAH PFASW NS Sbjct: 1 PNDRAQRDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 53 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 78 GVTQLNRLAAHPPFASWSNS 97 Score = 38.3 bits (85), Expect = 0.006 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWS-NSEEARTDRPSQQLR 110 >SB_132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = +3 Query: 588 KTLGVTQLNRLAAHXPFASWGNS 656 K GVTQLNRLAAH PFASW NS Sbjct: 49 KNPGVTQLNRLAAHPPFASWRNS 71 Score = 33.9 bits (74), Expect = 0.13 Identities = 21/46 (45%), Positives = 24/46 (52%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQL 694 LAVVLQRRDW+NPG + PF + RPSQQL Sbjct: 39 LAVVLQRRDWKNPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQL 83 >SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 42.3 bits (95), Expect = 4e-04 Identities = 22/40 (55%), Positives = 26/40 (65%), Gaps = 7/40 (17%) Frame = +3 Query: 558 WPSFYNVVTG-------KTLGVTQLNRLAAHXPFASWGNS 656 + S+YN + G + GVTQLNRLAAH PFASW NS Sbjct: 45 YESYYNSLAGVLQRRDWENPGVTQLNRLAAHPPFASWRNS 84 >SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 42.3 bits (95), Expect = 4e-04 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNSXR 662 GVTQLNRLAAH PFASW NS + Sbjct: 136 GVTQLNRLAAHPPFASWRNSEK 157 Score = 38.3 bits (85), Expect = 0.006 Identities = 23/47 (48%), Positives = 26/47 (55%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF ++ RPSQQLR Sbjct: 123 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEKARTDRPSQQLR 168 >SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 42.3 bits (95), Expect = 4e-04 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNSXR 662 GVTQLNRLAAH PFASW NS + Sbjct: 71 GVTQLNRLAAHPPFASWRNSEK 92 Score = 38.3 bits (85), Expect = 0.006 Identities = 23/47 (48%), Positives = 26/47 (55%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF ++ RPSQQLR Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEKARTDRPSQQLR 103 >SB_51296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 42.3 bits (95), Expect = 4e-04 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = +3 Query: 588 KTLGVTQLNRLAAHXPFASWGNS 656 K G+TQLNRLAAH PFASW NS Sbjct: 25 KNPGITQLNRLAAHPPFASWRNS 47 Score = 33.9 bits (74), Expect = 0.13 Identities = 21/46 (45%), Positives = 24/46 (52%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQL 694 LAVVLQRRDW+NPG + PF + RPSQQL Sbjct: 15 LAVVLQRRDWKNPGITQLNRLAAHPPFASWR-NSEETRTDRPSQQL 59 >SB_36241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 42.3 bits (95), Expect = 4e-04 Identities = 23/35 (65%), Positives = 24/35 (68%), Gaps = 1/35 (2%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNSXRGPHRIAXP-NSCA 698 GVTQLNRLAAH PFASW NS R P +SCA Sbjct: 67 GVTQLNRLAAHPPFASWRNSEEA--RTDRPSHSCA 99 Score = 34.7 bits (76), Expect = 0.073 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 557 LAVVLQRRDWENPG 598 LAVVLQRRDWENPG Sbjct: 54 LAVVLQRRDWENPG 67 >SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.3 bits (95), Expect = 4e-04 Identities = 22/40 (55%), Positives = 26/40 (65%), Gaps = 7/40 (17%) Frame = +3 Query: 558 WPSFYNVVTG-------KTLGVTQLNRLAAHXPFASWGNS 656 + S+YN + G + GVTQLNRLAAH PFASW NS Sbjct: 58 YESYYNSLAGVLQRRDWENPGVTQLNRLAAHPPFASWRNS 97 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 48 GVTQLNRLAAHPPFASWRNS 67 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 80 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 28 GVTQLNRLAAHPPFASWRNS 47 Score = 31.1 bits (67), Expect = 0.90 Identities = 19/43 (44%), Positives = 21/43 (48%) Frame = +2 Query: 569 LQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LQRRDWENPG + PF + RPSQQLR Sbjct: 19 LQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 60 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 42 GVTQLNRLAAHPPFASWRNS 61 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 74 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 75 GVTQLNRLAAHPPFASWRNS 94 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 107 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 57 GVTQLNRLAAHPPFASWRNS 76 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 89 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 49 GVTQLNRLAAHPPFASWRNS 68 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 81 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 75 GVTQLNRLAAHPPFASWRNS 94 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 107 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 55 GVTQLNRLAAHPPFASWRNS 74 Score = 34.3 bits (75), Expect = 0.096 Identities = 22/47 (46%), Positives = 24/47 (51%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWEN G + PF + RPSQQLR Sbjct: 42 LAVVLQRRDWENTGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 87 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 80 GVTQLNRLAAHPPFASWRNS 99 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 112 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 51 GVTQLNRLAAHPPFASWRNS 70 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 83 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 71 GVTQLNRLAAHPPFASWRNS 90 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 103 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 83 GVTQLNRLAAHPPFASWRNS 102 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 115 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 42 GVTQLNRLAAHPPFASWRNS 61 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 74 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 59 GVTQLNRLAAHPPFASWRNS 78 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 91 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 48 GVTQLNRLAAHPPFASWRNS 67 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 80 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 38 GVTQLNRLAAHPPFASWRNS 57 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 25 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 70 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 63 GVTQLNRLAAHPPFASWRNS 82 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 95 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 72 GVTQLNRLAAHPPFASWRNS 91 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 104 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 66 GVTQLNRLAAHPPFASWRNS 85 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 98 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 82 GVTQLNRLAAHPPFASWRNS 101 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 114 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 70 GVTQLNRLAAHPPFASWRNS 89 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 102 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 53 GVTQLNRLAAHPPFASWRNS 72 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 85 >SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 42 GVTQLNRLAAHPPFASWRNS 61 Score = 34.3 bits (75), Expect = 0.096 Identities = 22/47 (46%), Positives = 24/47 (51%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWEN G + PF + RPSQQLR Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 74 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 53 GVTQLNRLAAHPPFASWRNS 72 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 229 GVTQLNRLAAHPPFASWRNS 248 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 216 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 261 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 124 GVTQLNRLAAHPPFASWRNS 143 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 111 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 156 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 62 GVTQLNRLAAHPPFASWRNS 81 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 94 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 41 GVTQLNRLAAHPPFASWRNS 60 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 73 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 42 GVTQLNRLAAHPPFASWRNS 61 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 74 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 29 GVTQLNRLAAHPPFASWRNS 48 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 61 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 60 GVTQLNRLAAHPPFASWRNS 79 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 47 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 92 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 394 GVTQLNRLAAHPPFASWRNS 413 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 381 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 426 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 42 GVTQLNRLAAHPPFASWRNS 61 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 74 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 42 GVTQLNRLAAHPPFASWRNS 61 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 74 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 120 GVTQLNRLAAHPPFASWRNS 139 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 107 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 152 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 42 GVTQLNRLAAHPPFASWRNS 61 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 74 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 96 GVTQLNRLAAHPPFASWRNS 115 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 128 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 52 GVTQLNRLAAHPPFASWRNS 71 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 84 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 21 GVTQLNRLAAHPPFASWRNS 40 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 8 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 53 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 31 GVTQLNRLAAHPPFASWRNS 50 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 63 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 51 GVTQLNRLAAHPPFASWRNS 70 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 83 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 42 GVTQLNRLAAHPPFASWRNS 61 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 74 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 116 GVTQLNRLAAHPPFASWRNS 135 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 103 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 148 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 58 GVTQLNRLAAHPPFASWRNS 77 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 90 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 353 GVTQLNRLAAHPPFASWRNS 372 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 385 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 93 GVTQLNRLAAHPPFASWRNS 112 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 80 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 125 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 63 GVTQLNRLAAHPPFASWRNS 82 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 95 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 42 GVTQLNRLAAHPPFASWRNS 61 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 74 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 29 GVTQLNRLAAHPPFASWRNS 48 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 61 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 72 GVTQLNRLAAHPPFASWRNS 91 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 104 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 56 GVTQLNRLAAHPPFASWRNS 75 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 88 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 147 GVTQLNRLAAHPPFASWRNS 166 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 134 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 179 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 42 GVTQLNRLAAHPPFASWRNS 61 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 74 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 76 GVTQLNRLAAHPPFASWRNS 95 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 108 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 52 GVTQLNRLAAHPPFASWRNS 71 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 84 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 156 GVTQLNRLAAHPPFASWRNS 175 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 143 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 188 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 846 GVTQLNRLAAHPPFASWRNS 865 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 833 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 878 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 29 GVTQLNRLAAHPPFASWRNS 48 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 61 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 73 GVTQLNRLAAHPPFASWRNS 92 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 105 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 47 GVTQLNRLAAHPPFASWRNS 66 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 79 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 86 GVTQLNRLAAHPPFASWRNS 105 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 118 >SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 48 GVTQLNRLAAHPPFASWRNS 67 Score = 34.3 bits (75), Expect = 0.096 Identities = 22/47 (46%), Positives = 24/47 (51%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWEN G + PF + RPSQQLR Sbjct: 35 LAVVLQRRDWENTGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 80 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 69 GVTQLNRLAAHPPFASWRNS 88 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 101 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 82 GVTQLNRLAAHPPFASWRNS 101 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 114 >SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 78 GVTQLNRLAAHPPFASWRNS 97 Score = 34.7 bits (76), Expect = 0.073 Identities = 22/47 (46%), Positives = 24/47 (51%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQR DWENPG + PF + RPSQQLR Sbjct: 65 LAVVLQRLDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 110 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 42 GVTQLNRLAAHPPFASWRNS 61 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 74 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 269 GVTQLNRLAAHPPFASWRNS 288 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 256 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 301 >SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 42 GVTQLNRLAAHPPFASWRNS 61 Score = 34.3 bits (75), Expect = 0.096 Identities = 22/47 (46%), Positives = 24/47 (51%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWEN G + PF + RPSQQLR Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 74 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 42 GVTQLNRLAAHPPFASWRNS 61 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 74 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 127 GVTQLNRLAAHPPFASWRNS 146 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 159 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 63 GVTQLNRLAAHPPFASWRNS 82 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 95 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 49 GVTQLNRLAAHPPFASWRNS 68 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 81 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 50 GVTQLNRLAAHPPFASWRNS 69 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 82 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 114 GVTQLNRLAAHPPFASWRNS 133 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 101 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 146 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 127 GVTQLNRLAAHPPFASWRNS 146 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 159 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 52 GVTQLNRLAAHPPFASWRNS 71 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 84 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 33 GVTQLNRLAAHPPFASWRNS 52 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 65 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 71 GVTQLNRLAAHPPFASWRNS 90 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 103 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 50 GVTQLNRLAAHPPFASWRNS 69 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 82 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 47 GVTQLNRLAAHPPFASWRNS 66 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 79 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 24 GVTQLNRLAAHPPFASWRNS 43 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 11 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 56 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 32 GVTQLNRLAAHPPFASWRNS 51 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 64 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 409 GVTQLNRLAAHPPFASWRNS 428 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 396 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 441 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 58 GVTQLNRLAAHPPFASWRNS 77 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 90 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 67 GVTQLNRLAAHPPFASWRNS 86 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 99 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 49 GVTQLNRLAAHPPFASWRNS 68 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 81 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 42 GVTQLNRLAAHPPFASWRNS 61 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 74 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 132 GVTQLNRLAAHPPFASWRNS 151 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 119 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 164 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 68 GVTQLNRLAAHPPFASWRNS 87 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 100 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 78 GVTQLNRLAAHPPFASWRNS 97 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 110 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 81 GVTQLNRLAAHPPFASWRNS 100 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 113 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 427 GVTQLNRLAAHPPFASWRNS 446 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 414 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 459 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 42 GVTQLNRLAAHPPFASWRNS 61 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 74 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 124 GVTQLNRLAAHPPFASWRNS 143 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 111 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 156 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 80 GVTQLNRLAAHPPFASWRNS 99 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 112 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 69 GVTQLNRLAAHPPFASWRNS 88 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 101 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 59 GVTQLNRLAAHPPFASWRNS 78 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 91 >SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 42 GVTQLNRLAAHPPFASWRNS 61 Score = 34.3 bits (75), Expect = 0.096 Identities = 22/47 (46%), Positives = 24/47 (51%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWEN G + PF + RPSQQLR Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 74 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 174 GVTQLNRLAAHPPFASWRNS 193 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 161 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 206 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 42 GVTQLNRLAAHPPFASWRNS 61 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 74 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 78 GVTQLNRLAAHPPFASWRNS 97 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 110 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 65 GVTQLNRLAAHPPFASWRNS 84 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 52 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 97 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 101 GVTQLNRLAAHPPFASWRNS 120 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 133 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 67 GVTQLNRLAAHPPFASWRNS 86 Score = 34.3 bits (75), Expect = 0.096 Identities = 22/47 (46%), Positives = 24/47 (51%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWEN G + PF + RPSQQLR Sbjct: 54 LAVVLQRRDWENTGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 99 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 50 GVTQLNRLAAHPPFASWRNS 69 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 82 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 76 GVTQLNRLAAHPPFASWRNS 95 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 108 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 42 GVTQLNRLAAHPPFASWRNS 61 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 74 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 42 GVTQLNRLAAHPPFASWRNS 61 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 74 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 55 GVTQLNRLAAHPPFASWRNS 74 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 42 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 87 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 42 GVTQLNRLAAHPPFASWRNS 61 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 74 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 198 GVTQLNRLAAHPPFASWRNS 217 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 185 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 230 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 47 GVTQLNRLAAHPPFASWRNS 66 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 79 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 53 GVTQLNRLAAHPPFASWRNS 72 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 85 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 67 GVTQLNRLAAHPPFASWRNS 86 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 99 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 64 GVTQLNRLAAHPPFASWRNS 83 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 51 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 96 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 42 GVTQLNRLAAHPPFASWRNS 61 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 74 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 47 GVTQLNRLAAHPPFASWRNS 66 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 79 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 48 GVTQLNRLAAHPPFASWRNS 67 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 80 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 62 GVTQLNRLAAHPPFASWRNS 81 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 94 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 52 GVTQLNRLAAHPPFASWRNS 71 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 84 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 145 GVTQLNRLAAHPPFASWRNS 164 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 132 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 177 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 42 GVTQLNRLAAHPPFASWRNS 61 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 74 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 54 GVTQLNRLAAHPPFASWRNS 73 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 86 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 97 GVTQLNRLAAHPPFASWRNS 116 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 129 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 35 GVTQLNRLAAHPPFASWRNS 54 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 67 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 42 GVTQLNRLAAHPPFASWRNS 61 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 74 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 166 GVTQLNRLAAHPPFASWRNS 185 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 153 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 198 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 353 GVTQLNRLAAHPPFASWRNS 372 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 385 >SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 42 GVTQLNRLAAHPPFASWRNS 61 Score = 34.3 bits (75), Expect = 0.096 Identities = 22/47 (46%), Positives = 24/47 (51%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWEN G + PF + RPSQQLR Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 74 >SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) Length = 181 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 103 GVTQLNRLAAHPPFASWRNS 122 Score = 34.3 bits (75), Expect = 0.096 Identities = 22/47 (46%), Positives = 24/47 (51%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWEN G + PF + RPSQQLR Sbjct: 90 LAVVLQRRDWENTGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 135 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 70 GVTQLNRLAAHPPFASWRNS 89 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 102 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 34 GVTQLNRLAAHPPFASWRNS 53 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 66 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 60 GVTQLNRLAAHPPFASWRNS 79 Score = 35.1 bits (77), Expect = 0.055 Identities = 22/47 (46%), Positives = 24/47 (51%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 L VVLQRRDWENPG + PF + RPSQQLR Sbjct: 47 LDVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 92 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 122 GVTQLNRLAAHPPFASWRNS 141 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 109 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 154 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 42 GVTQLNRLAAHPPFASWRNS 61 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 74 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 42 GVTQLNRLAAHPPFASWRNS 61 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 74 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 99 GVTQLNRLAAHPPFASWRNS 118 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 86 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 131 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 49 GVTQLNRLAAHPPFASWRNS 68 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 81 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 73 GVTQLNRLAAHPPFASWRNS 92 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 105 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 307 GVTQLNRLAAHPPFASWRNS 326 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 294 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 339 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 70 GVTQLNRLAAHPPFASWRNS 89 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 102 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 71 GVTQLNRLAAHPPFASWRNS 90 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 103 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 29 GVTQLNRLAAHPPFASWRNS 48 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 61 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 49 GVTQLNRLAAHPPFASWRNS 68 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 81 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 424 GVTQLNRLAAHPPFASWRNS 443 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 411 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 456 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 108 GVTQLNRLAAHPPFASWRNS 127 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 95 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 140 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 64 GVTQLNRLAAHPPFASWRNS 83 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 51 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 96 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 56 GVTQLNRLAAHPPFASWRNS 75 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 88 >SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 42 GVTQLNRLAAHPPFASWRNS 61 Score = 34.3 bits (75), Expect = 0.096 Identities = 22/47 (46%), Positives = 24/47 (51%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWEN G + PF + RPSQQLR Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 74 >SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 55 GVTQLNRLAAHPPFASWRNS 74 Score = 34.3 bits (75), Expect = 0.096 Identities = 22/47 (46%), Positives = 24/47 (51%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWEN G + PF + RPSQQLR Sbjct: 42 LAVVLQRRDWENTGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 87 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 106 GVTQLNRLAAHPPFASWRNS 125 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 138 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 56 GVTQLNRLAAHPPFASWRNS 75 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 88 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 224 GVTQLNRLAAHPPFASWRNS 243 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 211 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 256 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 56 GVTQLNRLAAHPPFASWRNS 75 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 88 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 226 GVTQLNRLAAHPPFASWRNS 245 Score = 37.9 bits (84), Expect = 0.008 Identities = 29/85 (34%), Positives = 39/85 (45%) Frame = +2 Query: 443 TQYVHTHHG*DLARAS*RTELTGGPVXXXXXXXXXXXXLAVVLQRRDWENPGRYPT*SPC 622 TQ ++T++ +R + R ++ V LAVVLQRRDWENPG Sbjct: 177 TQTLNTNY--QASRRTRRVKIEDTDVSTESTCRHASLALAVVLQRRDWENPGVTQLNRLA 234 Query: 623 STSPFRQLG**RKRPAPXRPSQQLR 697 + PF + RPSQQLR Sbjct: 235 AHPPFASWR-NSEEARTDRPSQQLR 258 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 46 GVTQLNRLAAHPPFASWRNS 65 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 33 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 78 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 42 GVTQLNRLAAHPPFASWRNS 61 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 74 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 61 GVTQLNRLAAHPPFASWRNS 80 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 93 >SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 51 GVTQLNRLAAHPPFASWRNS 70 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 83 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 56 GVTQLNRLAAHPPFASWRNS 75 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 88 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 160 GVTQLNRLAAHPPFASWRNS 179 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 147 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 192 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 64 GVTQLNRLAAHPPFASWRNS 83 Score = 34.3 bits (75), Expect = 0.096 Identities = 22/47 (46%), Positives = 24/47 (51%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWEN G + PF + RPSQQLR Sbjct: 51 LAVVLQRRDWENTGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 96 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 58 GVTQLNRLAAHPPFASWRNS 77 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 90 >SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 48 GVTQLNRLAAHPPFASWRNS 67 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 80 >SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 68 GVTQLNRLAAHPPFASWRNS 87 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 100 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 53 GVTQLNRLAAHPPFASWRNS 72 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 85 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 88 GVTQLNRLAAHPPFASWRNS 107 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 75 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 120 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +3 Query: 597 GVTQLNRLAAHXPFASWGNS 656 GVTQLNRLAAH PFASW NS Sbjct: 208 GVTQLNRLAAHPPFASWRNS 227 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 557 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLG**RKRPAPXRPSQQLR 697 LAVVLQRRDWENPG + PF + RPSQQLR Sbjct: 195 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLR 240 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,062,227 Number of Sequences: 59808 Number of extensions: 389263 Number of successful extensions: 7996 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4663 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7638 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -