BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30593.Seq (698 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 25 0.69 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 23 2.1 L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. 21 8.5 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 8.5 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 25.0 bits (52), Expect = 0.69 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -3 Query: 510 TELVLDHSIVLLGAQLLPHTPHTVLLNLDDY 418 T LV ++ LG +LPH P++ L DY Sbjct: 251 TSLVTRQKLLELGWDVLPHPPYSPDLAPSDY 281 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 23.4 bits (48), Expect = 2.1 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = -1 Query: 311 RSEMIFQLQTSCHPSHLTVPPWRRTSDNILMNVVKF 204 RS + T C P + V P R + I +VKF Sbjct: 261 RSVDLVVTSTYCEPQVVIVSPTRELTIQIWQQIVKF 296 >L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. Length = 149 Score = 21.4 bits (43), Expect = 8.5 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 510 TELVLDHSIVLLGAQLLPHTP 448 T LV ++ LG +LPH P Sbjct: 129 TSLVTRQKLLELGWDVLPHPP 149 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.4 bits (43), Expect = 8.5 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +2 Query: 176 LDTSTMLPPQISQHSSKCCPMS 241 L+ M+PP I Q S PM+ Sbjct: 575 LEVQVMVPPTIQQFSFTKLPMN 596 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,394 Number of Sequences: 438 Number of extensions: 3618 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -