BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30588.Seq (877 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974169-1|ABJ52809.1| 508|Anopheles gambiae serpin 11 protein. 27 0.75 AJ001042-1|CAA04496.1| 395|Anopheles gambiae putative gram nega... 27 0.75 AF081533-1|AAD29854.1| 395|Anopheles gambiae putative gram nega... 27 0.75 AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhi... 26 1.7 AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled ... 25 4.0 AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin bi... 25 4.0 AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein ... 24 5.3 DQ139945-1|ABA29466.1| 399|Anopheles gambiae protein O-fucosylt... 24 7.0 AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. 23 9.2 AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. 23 9.2 AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. 23 9.2 AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 23 9.2 AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. 23 9.2 AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase ... 23 9.2 AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydroge... 23 9.2 AF364132-1|AAL35508.1| 397|Anopheles gambiae putative odorant r... 23 9.2 >DQ974169-1|ABJ52809.1| 508|Anopheles gambiae serpin 11 protein. Length = 508 Score = 27.1 bits (57), Expect = 0.75 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -1 Query: 433 PQSVSSSCNANRCCYITQVRESN*RATSLSYNK 335 P + CN NRC Y T++ ++ ATS S +K Sbjct: 78 PSEQPAPCNGNRCTYDTRLSGAS-SATSTSMDK 109 >AJ001042-1|CAA04496.1| 395|Anopheles gambiae putative gram negative bacteria bindingprotein protein. Length = 395 Score = 27.1 bits (57), Expect = 0.75 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +1 Query: 703 QHRYSKTFHPYCLLWTPNNTSSNIMG 780 + +SK+F + +WTP+N + +I G Sbjct: 262 EQEFSKSFSTFGFVWTPDNITVSING 287 >AF081533-1|AAD29854.1| 395|Anopheles gambiae putative gram negative bacteria bindingprotein protein. Length = 395 Score = 27.1 bits (57), Expect = 0.75 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +1 Query: 703 QHRYSKTFHPYCLLWTPNNTSSNIMG 780 + +SK+F + +WTP+N + +I G Sbjct: 262 EQEFSKSFSTFGFVWTPDNITVSING 287 >AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhibitor protein protein. Length = 335 Score = 25.8 bits (54), Expect = 1.7 Identities = 11/38 (28%), Positives = 18/38 (47%) Frame = +2 Query: 143 WSLHNAKMAQNQTYNGLIVTEIEDSSLEHDSVKPSVVD 256 + +HN Y + TEI LE + +PSV++ Sbjct: 237 YCVHNKDCCSGACYKSVCSTEIRVGVLESELTRPSVIN 274 >AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled receptor 3 protein. Length = 605 Score = 24.6 bits (51), Expect = 4.0 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = +2 Query: 713 IRKHFIPIVCFGLPTILPVILWDGIVK*SPGNLTIMEIRLIKLSTVF 853 I++ I +C GL +L I+W V GN IR +++ + Sbjct: 265 IKQLAIADLCVGLLNVLTDIIWRITVVWRAGNAACKAIRFVQVCVTY 311 >AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin binding protein protein. Length = 567 Score = 24.6 bits (51), Expect = 4.0 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +1 Query: 412 SWSSQTVVPQIIQSKITSSNPTNGLSFTGQSKTT 513 S S+ T V S TSS+ T S + SKTT Sbjct: 531 SQSNNTTVVSTPSSSTTSSSSTTSSSSSSSSKTT 564 >AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein protein. Length = 680 Score = 24.2 bits (50), Expect = 5.3 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -1 Query: 604 MRIKEAHGLRYVDLRPYRC 548 MR E+H L + D +PY+C Sbjct: 367 MRHLESHLLLHTDQKPYKC 385 >DQ139945-1|ABA29466.1| 399|Anopheles gambiae protein O-fucosyltransferase 1 protein. Length = 399 Score = 23.8 bits (49), Expect = 7.0 Identities = 8/27 (29%), Positives = 16/27 (59%) Frame = +1 Query: 244 FSGRPREYEIVYKNIFIHIYLHVTMFY 324 F+G P + + +N+ +H YL ++ Y Sbjct: 187 FTGAPAAFPVQQENLLLHRYLRWSVKY 213 >AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.4 bits (48), Expect = 9.2 Identities = 13/57 (22%), Positives = 24/57 (42%) Frame = +1 Query: 343 TTAKWPFSWIRVPVLCSSNDWRYSWSSQTVVPQIIQSKITSSNPTNGLSFTGQSKTT 513 TT P + P ++ DW + +++ + T+S PT +T + TT Sbjct: 98 TTTLRPTTTTLRPTTTTTTDWITTTTTEATTTTTFPTTTTTSAPTTPSQWTDPTITT 154 >AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.4 bits (48), Expect = 9.2 Identities = 13/57 (22%), Positives = 24/57 (42%) Frame = +1 Query: 343 TTAKWPFSWIRVPVLCSSNDWRYSWSSQTVVPQIIQSKITSSNPTNGLSFTGQSKTT 513 TT P + P ++ DW + +++ + T+S PT +T + TT Sbjct: 98 TTTLRPTTTTLRPTTTTTTDWITTTTTEATTTTTFPTTTTTSAPTTPSQWTDPTITT 154 >AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.4 bits (48), Expect = 9.2 Identities = 13/57 (22%), Positives = 24/57 (42%) Frame = +1 Query: 343 TTAKWPFSWIRVPVLCSSNDWRYSWSSQTVVPQIIQSKITSSNPTNGLSFTGQSKTT 513 TT P + P ++ DW + +++ + T+S PT +T + TT Sbjct: 98 TTTLRPTTTTLRPTTTTTTDWITTTTTEATTTTTFPTTTTTSAPTTPSQWTDPTITT 154 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.4 bits (48), Expect = 9.2 Identities = 13/57 (22%), Positives = 24/57 (42%) Frame = +1 Query: 343 TTAKWPFSWIRVPVLCSSNDWRYSWSSQTVVPQIIQSKITSSNPTNGLSFTGQSKTT 513 TT P + P ++ DW + +++ + T+S PT +T + TT Sbjct: 98 TTTLRPTTTTLRPTTTTTTDWITTTTTEATTTTTFPTTTTTSAPTTPSQWTDPTITT 154 >AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.4 bits (48), Expect = 9.2 Identities = 13/57 (22%), Positives = 24/57 (42%) Frame = +1 Query: 343 TTAKWPFSWIRVPVLCSSNDWRYSWSSQTVVPQIIQSKITSSNPTNGLSFTGQSKTT 513 TT P + P ++ DW + +++ + T+S PT +T + TT Sbjct: 98 TTTLRPTTTTLRPTTTTTTDWITTTTTEATTTTTFPTTTTTSAPTTPSQWTDPTITT 154 >AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase protein. Length = 808 Score = 23.4 bits (48), Expect = 9.2 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +2 Query: 386 YVAATIGVTAGAHRLWSHKSYKARLPLQILLMVF 487 Y+ +TI TA RLW+ A L + MVF Sbjct: 698 YILSTISHTASYLRLWALSLAHAELSEVLYNMVF 731 >AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydrogenase protein. Length = 1325 Score = 23.4 bits (48), Expect = 9.2 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +3 Query: 84 GPEMGAVLHASKVKCSALVLGV 149 G EMG LH ++ +A LG+ Sbjct: 1026 GTEMGQGLHTKMIQVAATALGI 1047 >AF364132-1|AAL35508.1| 397|Anopheles gambiae putative odorant receptor Or4 protein. Length = 397 Score = 23.4 bits (48), Expect = 9.2 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 324 WPISLLYDSEVALQLDSRTCVM 389 W ISL+Y + V + L S T V+ Sbjct: 281 WSISLIYLTNVGISLQSVTVVV 302 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 992,092 Number of Sequences: 2352 Number of extensions: 20589 Number of successful extensions: 54 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 52 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 54 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 93853377 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -