BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30581.Seq (528 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL132902-1|CAB81996.1| 246|Caenorhabditis elegans Hypothetical ... 145 2e-35 AF078787-7|AAC26954.2| 518|Caenorhabditis elegans Vegf (vascula... 28 3.6 >AL132902-1|CAB81996.1| 246|Caenorhabditis elegans Hypothetical protein Y71A12B.1 protein. Length = 246 Score = 145 bits (351), Expect = 2e-35 Identities = 76/156 (48%), Positives = 94/156 (60%) Frame = +2 Query: 41 MKLNVSYPATGMPEVVRSGGRAQASYLLRKAHXXXXXXXXXXXXMEGLCTSCRWRQRQAR 220 M+LN +YPATG+ + + K +G + Sbjct: 1 MRLNFAYPATGLQKSFEVDEEKKLRLFFEKRMSQEVAIDALGDEWKGYVVRIGGGNDKQG 60 Query: 221 IPDETGRPDKQRVRLLMSKGHSCYRPRRDGERKRKSVRGCIVDANLSVLALVIVRKGAQE 400 P + G RVRLL+ KG SCYR R++GERKRKSVRGCIVDAN+S L+LVIV+KG E Sbjct: 61 FPMKQGILTNGRVRLLLKKGQSCYRERKNGERKRKSVRGCIVDANMSALSLVIVKKGDGE 120 Query: 401 IPGLTDGNVPRRLGPKRASKIRKLFNLSKEDDVRRY 508 I GLTD +PR+LGPKRASKIRKLFNL+K DDV +Y Sbjct: 121 IEGLTDSVLPRKLGPKRASKIRKLFNLTKHDDVTKY 156 >AF078787-7|AAC26954.2| 518|Caenorhabditis elegans Vegf (vascular endothelial growthfactor) receptor family protein 2 protein. Length = 518 Score = 28.3 bits (60), Expect = 3.6 Identities = 15/50 (30%), Positives = 24/50 (48%) Frame = +3 Query: 69 RACQKLFEVVDEHKLRIFYEKRMGAEVEADQLGDEWKGYVLRVAGGNDKQ 218 + C K F+ + ++ E+++ E E Q D W G LR G DK+ Sbjct: 270 KECVKFFKNYMQEEVVQNIERKLQFEREEQQELDSWTGKSLRAEGVEDKE 319 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,978,737 Number of Sequences: 27780 Number of extensions: 281315 Number of successful extensions: 681 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 666 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 679 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1038911524 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -