BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30579.Seq (748 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0724 - 27147479-27147706,27147830-27147920,27148002-271480... 33 0.24 01_03_0084 - 12286416-12286514,12286632-12286683,12286771-122868... 33 0.24 06_03_0914 + 25920277-25920405,25920783-25920810,25920890-259209... 31 0.74 07_03_1163 - 24439976-24440023,24440562-24440597,24440932-244410... 31 0.97 01_01_1069 - 8420454-8420670,8421272-8421447,8421556-8421738,842... 31 0.97 03_06_0003 + 30921197-30921388,30921514-30921632,30921742-309218... 30 1.7 11_06_0263 + 21777178-21777342,21777742-21777823,21777939-217780... 30 2.2 08_01_0410 + 3661304-3661383,3661494-3661673,3661757-3661870,366... 30 2.2 10_01_0025 - 328105-328188,328281-328337,328680-328734,328809-32... 29 3.0 11_01_0488 + 3770410-3770774,3771197-3771284,3771383-3771466,377... 29 3.9 05_06_0102 - 25589011-25589181,25589269-25589496,25589589-255899... 29 3.9 12_01_0471 - 3672309-3672740,3673159-3673251,3673271-3673399,367... 29 5.2 05_04_0194 + 18949268-18951514,18952063-18952215,18952304-18954241 29 5.2 03_05_0700 + 26920743-26920771,26920880-26920991,26921205-269213... 29 5.2 01_06_0303 + 28324155-28325045,28326208-28326321 29 5.2 03_05_0525 + 25200207-25200580,25201061-25201751 28 6.9 03_05_0522 - 25161595-25162285,25162394-25163139 28 6.9 03_02_0400 - 8135283-8135490,8136047-8136213,8136289-8136477,813... 28 6.9 >03_05_0724 - 27147479-27147706,27147830-27147920,27148002-27148060, 27148197-27148312,27148389-27148472,27148677-27148824, 27148958-27149103,27149610-27149729,27149900-27149998, 27150787-27150828,27150915-27151017 Length = 411 Score = 33.1 bits (72), Expect = 0.24 Identities = 18/53 (33%), Positives = 26/53 (49%) Frame = +2 Query: 14 FSEDGKYYSTITKDGRLKIWDTETNVLKQEYTPDLHLTSPPTCLQWTTVSQSV 172 F+ DGK T + D L+IWD T + + T TCL T+ SQ++ Sbjct: 216 FTPDGKLICTGSDDASLRIWDPRTAQSRHVVRGHGYHTDGLTCLSVTSDSQTI 268 Score = 29.9 bits (64), Expect = 2.2 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +2 Query: 14 FSEDGKYYSTITKDGRLKIWDTETNVLK 97 FS DG ++ + DGR+ +W+T T L+ Sbjct: 132 FSSDGNLLASGSFDGRINVWNTATRTLQ 159 >01_03_0084 - 12286416-12286514,12286632-12286683,12286771-12286871, 12287498-12287650,12287703-12287762,12287872-12287998, 12288581-12288708,12289196-12289291,12289473-12289526, 12289603-12289689,12290954-12291057,12291163-12291246, 12291374-12291422,12291523-12291886,12292186-12292226 Length = 532 Score = 33.1 bits (72), Expect = 0.24 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +2 Query: 8 AMFSEDGKYYSTITKDGRLKIWDTETNVLKQEYTP 112 A+FS DG T + D +K+WDT+T Q + P Sbjct: 359 AIFSTDGSRVITASSDCTVKVWDTKTTDCLQTFKP 393 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = +2 Query: 8 AMFSEDGKYYSTITKDGRLKIWDTETNVLKQE 103 A FS DG+Y + + DG +++WD + LK++ Sbjct: 224 ARFSPDGQYLVSCSVDGIIEVWDYISGKLKKD 255 >06_03_0914 + 25920277-25920405,25920783-25920810,25920890-25920990, 25921356-25921479,25921793-25921903,25922222-25922397, 25922766-25922848,25922935-25923007,25923630-25923695, 25923776-25923818,25924600-25924739,25924878-25925090, 25925397-25925481,25925558-25925852,25926855-25927110, 25927237-25927450,25927701-25927912,25928054-25928203 Length = 832 Score = 31.5 bits (68), Expect = 0.74 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 14 FSEDGKYYSTITKDGRLKIWD 76 FSEDGK+ + + DG L+IWD Sbjct: 495 FSEDGKWLISSSMDGTLRIWD 515 >07_03_1163 - 24439976-24440023,24440562-24440597,24440932-24441018, 24441349-24441492,24441782-24441916,24442215-24442279, 24442395-24442477,24442607-24442642,24443343-24443449, 24443558-24443658,24443750-24443909 Length = 333 Score = 31.1 bits (67), Expect = 0.97 Identities = 12/37 (32%), Positives = 24/37 (64%) Frame = +1 Query: 334 VTALDWSRKYGLYSCTKDSRVYEWNIEDGSVKQTYNI 444 V+A+ W + +YS + D V +W+++ G K+T+N+ Sbjct: 243 VSAVTWPERQTIYSASWDHSVRQWDVQTG--KETWNM 277 >01_01_1069 - 8420454-8420670,8421272-8421447,8421556-8421738, 8421885-8421980,8422064-8422192,8422266-8422445, 8422524-8422634,8422714-8422869,8422983-8423078, 8423160-8423327,8423402-8423642,8423724-8423851, 8424042-8424134,8424214-8424309,8424431-8424523, 8424741-8424850,8424999-8425134,8425215-8425315, 8426029-8426152,8426237-8426411,8426523-8426681, 8427423-8427536,8427669-8427848,8428926-8429005 Length = 1113 Score = 31.1 bits (67), Expect = 0.97 Identities = 25/96 (26%), Positives = 44/96 (45%), Gaps = 5/96 (5%) Frame = +1 Query: 169 SFELKREPKQFKCEYKRK*VPMHSIRHYNGKLLIYSISQ-AKIINVWVPAKHFSAKVTAL 345 SFE P C + ++ + +GK+ + ++ P K + + + Sbjct: 467 SFEGHEAPVYSICPHHKESIQFIFSTSLDGKIKAWLYDHMGSRVDYDAPGKWCTTMLYSA 526 Query: 346 DWSRKYGLYSC--TKDSRVY--EWNIEDGSVKQTYN 441 D +R L+SC +KD Y EWN +GS+K+TY+ Sbjct: 527 DGTR---LFSCGTSKDGDSYLVEWNESEGSIKRTYS 559 >03_06_0003 + 30921197-30921388,30921514-30921632,30921742-30921811, 30922078-30922161,30922258-30922344,30922431-30922501, 30922648-30922702,30923374-30923509,30925009-30925103, 30925203-30925357,30925435-30925543,30925761-30925817, 30925913-30926027,30926177-30926264,30926738-30927501, 30927600-30927688,30928315-30928422,30928550-30928657, 30928887-30928977,30929235-30929287,30929557-30929712, 30930763-30930825,30931491-30931535,30932075-30932130, 30933051-30933132,30933238-30933354,30933428-30933530, 30933912-30934062,30934180-30934417,30934564-30934764, 30934850-30934935,30935036-30935135 Length = 1347 Score = 30.3 bits (65), Expect = 1.7 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 Query: 5 EAMFSEDGKYYSTITKDGRLKIWD 76 + +S G Y T +KDG L+IWD Sbjct: 303 QVRYSSTGSLYVTASKDGSLRIWD 326 Score = 28.3 bits (60), Expect = 6.9 Identities = 20/64 (31%), Positives = 35/64 (54%), Gaps = 2/64 (3%) Frame = +1 Query: 253 NGKLLIYSISQAKIINVWVPAKHFSAKVTALDWSR--KYGLYSCTKDSRVYEWNIEDGSV 426 +G L I+ A+ + + A H SA+VT+ +++ +Y L SC KDS + W + G + Sbjct: 319 DGSLRIWDGISAECVRPIIGA-HASAEVTSAIFTKDERYVL-SCGKDSCIKLWEVGSGRL 376 Query: 427 KQTY 438 + Y Sbjct: 377 VKQY 380 >11_06_0263 + 21777178-21777342,21777742-21777823,21777939-21778028, 21778447-21778604,21778852-21778873,21779048-21779175, 21779486-21779685,21780600-21780663,21781594-21781704, 21781804-21781941,21782306-21782448,21782521-21782575, 21782921-21782977,21783093-21783176 Length = 498 Score = 29.9 bits (64), Expect = 2.2 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +2 Query: 14 FSEDGKYYSTITKDGRLKIWDTETNVLKQE 103 +S D + + +KD LK+WD T+ LKQ+ Sbjct: 435 WSADSRLLLSGSKDSTLKVWDIRTHKLKQD 464 >08_01_0410 + 3661304-3661383,3661494-3661673,3661757-3661870, 3661975-3662133,3662193-3662243,3662838-3663018, 3663102-3663228,3663322-3663431,3663529-3663667, 3663767-3663876,3664002-3664071,3664247-3664320, 3664458-3664553,3664682-3664777,3665041-3665168, 3665422-3665656,3665743-3665910,3666274-3666381, 3666468-3666617,3666905-3667015,3667118-3667297, 3667427-3667555,3667819-3667914,3668108-3668293, 3668431-3668603,3668720-3668921 Length = 1150 Score = 29.9 bits (64), Expect = 2.2 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +1 Query: 385 DSRVYEWNIEDGSVKQTYN 441 DS + EWN +G++K+TYN Sbjct: 583 DSHLVEWNETEGAIKRTYN 601 >10_01_0025 - 328105-328188,328281-328337,328680-328734,328809-328951, 330772-330909,331010-331120,332621-332684,334179-334378, 334678-334805,335468-335593,335828-335917,336035-336116, 336845-336910 Length = 447 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 14 FSEDGKYYSTITKDGRLKIWDTETNVLKQE 103 +S D + + +KD LK+WD T LKQ+ Sbjct: 384 WSADSRLLLSGSKDSTLKVWDIRTRKLKQD 413 >11_01_0488 + 3770410-3770774,3771197-3771284,3771383-3771466, 3772128-3772224,3772324-3772411,3772800-3772848, 3773044-3773238,3773713-3774159 Length = 470 Score = 29.1 bits (62), Expect = 3.9 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +2 Query: 14 FSEDGKYYSTITKDGRLKIWD 76 FS DG Y +TI +DG L+++D Sbjct: 198 FSPDGTYLATIGRDGYLRVFD 218 >05_06_0102 - 25589011-25589181,25589269-25589496,25589589-25589933, 25590406-25590777,25590957-25591049,25591150-25591401, 25592019-25593224 Length = 888 Score = 29.1 bits (62), Expect = 3.9 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 355 RKYGLYSCTKDSRVYEWNIEDGS 423 R G Y+ TKD ++ WN+ +GS Sbjct: 202 RVTGAYTITKDGAIFTWNLVEGS 224 >12_01_0471 - 3672309-3672740,3673159-3673251,3673271-3673399, 3673400-3673448,3674291-3674378,3674477-3674573, 3675195-3675278,3675377-3675464,3676589-3676715, 3676774-3676848,3676934-3677042,3677125-3677448, 3677863-3678039 Length = 623 Score = 28.7 bits (61), Expect = 5.2 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = +2 Query: 14 FSEDGKYYSTITKDGRLKIWD 76 FS DG Y +T+ +DG L+++D Sbjct: 347 FSPDGAYLATVGRDGYLRVFD 367 >05_04_0194 + 18949268-18951514,18952063-18952215,18952304-18954241 Length = 1445 Score = 28.7 bits (61), Expect = 5.2 Identities = 13/50 (26%), Positives = 23/50 (46%) Frame = +2 Query: 14 FSEDGKYYSTITKDGRLKIWDTETNVLKQEYTPDLHLTSPPTCLQWTTVS 163 F+E Y + D +K+ + N L+++ L P+C+ W T S Sbjct: 414 FNEGSSYIEILDSDEEVKVVNDTGNALRRKPLVPAKLPIVPSCVAWRTRS 463 >03_05_0700 + 26920743-26920771,26920880-26920991,26921205-26921306, 26921391-26921503,26921858-26921927,26922348-26922425, 26922500-26922616,26922738-26922832,26923080-26923159, 26923405-26923532 Length = 307 Score = 28.7 bits (61), Expect = 5.2 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +2 Query: 14 FSEDGKYYSTITKDGRLKIWDTETNVLKQEY 106 F DG + + ++DG ++IWD T ++EY Sbjct: 97 FHCDGNWMYSGSEDGTVRIWDLRTATCQREY 127 >01_06_0303 + 28324155-28325045,28326208-28326321 Length = 334 Score = 28.7 bits (61), Expect = 5.2 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = +2 Query: 5 EAMFSEDGKYYSTITKDGRLKIWDTETNVLKQEY 106 + + S DG++ + + DG L++WD T V + + Sbjct: 80 DVVLSSDGQFALSGSWDGELRLWDLSTGVTTRRF 113 >03_05_0525 + 25200207-25200580,25201061-25201751 Length = 354 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +2 Query: 17 SEDGKYYSTITKDGRLKIW 73 SE G Y +++T DGRL IW Sbjct: 154 SEKGVYLASLTIDGRLSIW 172 >03_05_0522 - 25161595-25162285,25162394-25163139 Length = 478 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +2 Query: 17 SEDGKYYSTITKDGRLKIW 73 SE G Y +++T DGRL IW Sbjct: 278 SEKGVYLASLTIDGRLSIW 296 >03_02_0400 - 8135283-8135490,8136047-8136213,8136289-8136477, 8136560-8136655,8136746-8136874,8136947-8137123, 8137256-8137366,8138592-8138792,8139022-8139186, 8139293-8139527,8139618-8139745,8139833-8139928, 8140017-8140112,8140252-8140325,8140393-8140462, 8140556-8140665,8140753-8140906,8141040-8141155, 8141259-8141379,8141464-8141641,8142331-8142489, 8142619-8142732,8142821-8143000,8143098-8143177 Length = 1117 Score = 28.3 bits (60), Expect = 6.9 Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 4/28 (14%) Frame = +1 Query: 367 LYSC--TKD--SRVYEWNIEDGSVKQTY 438 L+SC +KD S + EWN +G+VK+TY Sbjct: 560 LFSCGTSKDGESHLVEWNESEGAVKRTY 587 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,154,495 Number of Sequences: 37544 Number of extensions: 374755 Number of successful extensions: 861 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 795 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 861 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1980691104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -