BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30578.Seq (533 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 30 0.056 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 25 1.2 DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor... 24 3.7 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 29.9 bits (64), Expect = 0.056 Identities = 16/30 (53%), Positives = 20/30 (66%), Gaps = 3/30 (10%) Frame = -3 Query: 102 CGLS*ILCPPIAVHDGGSRVT---RRSYSS 22 CG S I PP A+H GGSR T +R+YS+ Sbjct: 874 CG-SGIASPPAAIHGGGSRTTTVLKRTYSN 902 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 25.4 bits (53), Expect = 1.2 Identities = 11/37 (29%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = -3 Query: 432 SWSLLFLFVESEERHV--GYFYHLKTNSGNVTDGVTF 328 S+ + F + +++ +V G+F+HL+ N G + TF Sbjct: 901 SYRMYFSQIAADDHYVPSGFFFHLRKNMGGLKRFSTF 937 >DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor 22 protein. Length = 467 Score = 23.8 bits (49), Expect = 3.7 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +2 Query: 71 MGGQRIQESPHGYEMEG*PFRWC 139 MG I SP G +M F WC Sbjct: 83 MGVMPIMRSPKGVDMPRTTFTWC 105 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 615,985 Number of Sequences: 2352 Number of extensions: 12387 Number of successful extensions: 22 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49474503 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -