BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30578.Seq (533 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g02960.1 68418.m00239 40S ribosomal protein S23 (RPS23B) ribo... 112 2e-25 At3g09680.1 68416.m01147 40S ribosomal protein S23 (RPS23A) simi... 103 7e-23 At5g50790.1 68418.m06292 nodulin MtN3 family protein similar to ... 29 2.6 At4g34138.1 68417.m04844 UDP-glucoronosyl/UDP-glucosyl transfera... 28 4.5 At1g32960.1 68414.m04059 subtilase family protein contains simil... 28 4.5 At1g32940.1 68414.m04057 subtilase family protein contains simil... 28 4.5 >At5g02960.1 68418.m00239 40S ribosomal protein S23 (RPS23B) ribosomal protein S23, Fragaria x ananassa, PIR:S56673 Length = 142 Score = 112 bits (269), Expect = 2e-25 Identities = 49/64 (76%), Positives = 57/64 (89%) Frame = +3 Query: 57 RREQRWADKEFKKAHMGTKWKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIK 236 R QRWADK++KK+H+G +WK PF G+SHAKGIVLEK+G+EAKQPNSAIRKC RVQLIK Sbjct: 17 RINQRWADKQYKKSHLGNEWK-KPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIK 75 Query: 237 NGKK 248 NGKK Sbjct: 76 NGKK 79 Score = 82.2 bits (194), Expect = 2e-16 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = +1 Query: 310 VAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 435 +AGFGRKGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS Sbjct: 101 IAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 142 Score = 37.1 bits (82), Expect = 0.007 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = +2 Query: 242 KESDPFVPRDGCLNHIEENDE 304 K+ FVP DGCLN+IEENDE Sbjct: 78 KKIAAFVPNDGCLNYIEENDE 98 >At3g09680.1 68416.m01147 40S ribosomal protein S23 (RPS23A) similar to 40S ribosomal protein S23 (S12) GB:P46297 from [Fragaria x ananassa] Length = 142 Score = 103 bits (247), Expect = 7e-23 Identities = 47/64 (73%), Positives = 54/64 (84%) Frame = +3 Query: 57 RREQRWADKEFKKAHMGTKWKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIK 236 R QRWADK +KK++ G +WK PF +SHAKGIVLEK+G+EAKQPNSAIRKC RVQLIK Sbjct: 17 RITQRWADKHYKKSNRGNEWK-KPFACSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIK 75 Query: 237 NGKK 248 NGKK Sbjct: 76 NGKK 79 Score = 82.2 bits (194), Expect = 2e-16 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = +1 Query: 310 VAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 435 +AGFGRKGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS Sbjct: 101 IAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 142 Score = 37.1 bits (82), Expect = 0.007 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = +2 Query: 242 KESDPFVPRDGCLNHIEENDE 304 K+ FVP DGCLN+IEENDE Sbjct: 78 KKIAAFVPNDGCLNYIEENDE 98 >At5g50790.1 68418.m06292 nodulin MtN3 family protein similar to MtN3 GI:1619602 (root nodule development) from [Medicago truncatula] Length = 289 Score = 28.7 bits (61), Expect = 2.6 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +1 Query: 370 VVKVANVSLLALYKEKKERPRS*VYIVISDLLSGSALFI 486 VV++ +SL Y KKE+ + +++ D+L A+F+ Sbjct: 80 VVQIVYISLFFFYAPKKEKTLTVKFVLFVDVLGFGAIFV 118 >At4g34138.1 68417.m04844 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 488 Score = 27.9 bits (59), Expect = 4.5 Identities = 13/57 (22%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = +2 Query: 8 KWVNPEEYERRVTREPPS*TAMGGQRIQESPHGYEMEG*PFRWCISRKGHR-PRESW 175 KW++ ++ + + + ++ +++ E G +M G F W ++RKG + +E W Sbjct: 280 KWLDSKKCDSVIYMAFGTMSSFKNEQLIEIAAGLDMSGHDFVWVVNRKGSQVEKEDW 336 >At1g32960.1 68414.m04059 subtilase family protein contains similarity to subtilase; SP1 GI:9957714 [Oryza sativa] Length = 777 Score = 27.9 bits (59), Expect = 4.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +3 Query: 72 WADKEFKKAHMGTKWKANPFGGASHAKG 155 W+ F+ A + T W+ +PFG A+G Sbjct: 575 WSPAAFRSAIVTTAWRTDPFGEQIFAEG 602 >At1g32940.1 68414.m04057 subtilase family protein contains similarity to subtilase; SP1 GI:9957714 from [Oryza sativa] Length = 774 Score = 27.9 bits (59), Expect = 4.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +3 Query: 72 WADKEFKKAHMGTKWKANPFGGASHAKG 155 W+ F+ A + T W+ +PFG A+G Sbjct: 572 WSPAAFRSAIVTTAWRTDPFGEQIFAEG 599 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,617,934 Number of Sequences: 28952 Number of extensions: 271945 Number of successful extensions: 583 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 562 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 581 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 984125600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -