BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30570.Seq (696 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g74160.1 68414.m08589 expressed protein 36 0.019 At1g05850.1 68414.m00612 chitinase-like protein 1 (CTL1) similar... 30 1.3 At3g59290.1 68416.m06609 epsin N-terminal homology (ENTH) domain... 29 2.2 At5g61160.1 68418.m07673 transferase family protein similar to a... 28 6.8 At2g44590.3 68415.m05551 dynamin-like protein D (DL1D) identical... 27 9.0 At2g44590.2 68415.m05550 dynamin-like protein D (DL1D) identical... 27 9.0 At2g44590.1 68415.m05549 dynamin-like protein D (DL1D) identical... 27 9.0 At1g65470.1 68414.m07427 chromatin assembly factor-1 (FASCIATA1)... 27 9.0 >At1g74160.1 68414.m08589 expressed protein Length = 1030 Score = 36.3 bits (80), Expect = 0.019 Identities = 16/54 (29%), Positives = 35/54 (64%) Frame = -2 Query: 590 NSHESRRAPAAPEDVPRLELDQGDEQTTTHNEF*PRVSRIVKEYEAACSSANKK 429 +SH++ ++ +++PRL LD E+ T ++ P+ S++ + + +CSS++KK Sbjct: 226 DSHDTLKSRQKLKELPRLSLD-SRERATRNSSVDPKSSKLSESFSESCSSSSKK 278 >At1g05850.1 68414.m00612 chitinase-like protein 1 (CTL1) similar to class I chitinase GI:7798656 from [Halimolobos perplexa var. perplexa]; contains Pfam profile PF00182: Chitinase class I; identical to cDNA chitinase-like protein 1 (CTL1) CTL1-ELP1 allele GI:17226328 Length = 321 Score = 30.3 bits (65), Expect = 1.3 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -3 Query: 145 GNDVSFQGWDAFWWTSVAC 89 GN V QGW+ WW+ C Sbjct: 38 GNKVCTQGWECSWWSKYCC 56 >At3g59290.1 68416.m06609 epsin N-terminal homology (ENTH) domain-containing protein contains Pfam PF01417: ENTH domain. ENTH (Epsin N-terminal homology) domain; similar to Af10-protein - Avena fatua, EMBL:U80041 Length = 1024 Score = 29.5 bits (63), Expect = 2.2 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = -2 Query: 650 PDFIKPAVTGTMPMMSYDP-GNSHESRRAPAAPEDV 546 P + P TMP + P GNS+ES AAP D+ Sbjct: 543 PVSLSPQPDSTMPTSQFHPNGNSYESYHHQAAPTDL 578 >At5g61160.1 68418.m07673 transferase family protein similar to anthocyanin 5-aromatic acyltransferase from Gentiana triflora GI:4185599, malonyl CoA:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase from Perilla frutescens GI:17980232, Salvia splendens GI:17980234; contains Pfam profile PF02458 transferase family Length = 452 Score = 27.9 bits (59), Expect = 6.8 Identities = 13/33 (39%), Positives = 23/33 (69%) Frame = +3 Query: 291 SKNSSTRDLPLAGFHGEVLPGGQRSLFILFTHF 389 +++SS+RD+ F+ +LP +RSL ++ THF Sbjct: 47 TESSSSRDV----FYSSILPKLERSLSLILTHF 75 >At2g44590.3 68415.m05551 dynamin-like protein D (DL1D) identical to dynamin-like protein D [Arabidopsis thaliana] GI:19569770; contains Pfam profiles PF01031: Dynamin central region, PF00350: Dynamin family, PF02212: Dynamin GTPase effector domain Length = 612 Score = 27.5 bits (58), Expect = 9.0 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = -3 Query: 529 TREMSRRPPTTNFDQEYQG*SRNTKRRVAAQIKRLAPILTN 407 ++ MS PT+ DQ G R VAA IK +A L N Sbjct: 500 SQNMSLSSPTSAIDQYGDGHFRKIASNVAAYIKMVAETLVN 540 >At2g44590.2 68415.m05550 dynamin-like protein D (DL1D) identical to dynamin-like protein D [Arabidopsis thaliana] GI:19569770; contains Pfam profiles PF01031: Dynamin central region, PF00350: Dynamin family, PF02212: Dynamin GTPase effector domain Length = 595 Score = 27.5 bits (58), Expect = 9.0 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = -3 Query: 529 TREMSRRPPTTNFDQEYQG*SRNTKRRVAAQIKRLAPILTN 407 ++ MS PT+ DQ G R VAA IK +A L N Sbjct: 483 SQNMSLSSPTSAIDQYGDGHFRKIASNVAAYIKMVAETLVN 523 >At2g44590.1 68415.m05549 dynamin-like protein D (DL1D) identical to dynamin-like protein D [Arabidopsis thaliana] GI:19569770; contains Pfam profiles PF01031: Dynamin central region, PF00350: Dynamin family, PF02212: Dynamin GTPase effector domain Length = 596 Score = 27.5 bits (58), Expect = 9.0 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = -3 Query: 529 TREMSRRPPTTNFDQEYQG*SRNTKRRVAAQIKRLAPILTN 407 ++ MS PT+ DQ G R VAA IK +A L N Sbjct: 483 SQNMSLSSPTSAIDQYGDGHFRKIASNVAAYIKMVAETLVN 523 >At1g65470.1 68414.m07427 chromatin assembly factor-1 (FASCIATA1) (FAS1) identical to FAS1 [Arabidopsis thaliana] GI:4887626 Length = 815 Score = 27.5 bits (58), Expect = 9.0 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 46 NFNTLNQYGRSKSASRRHWSTKRHPSLE 129 +F + Q G S+S++HW +R P E Sbjct: 401 HFASWRQLGHLLSSSKKHWGMRRQPKSE 428 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,572,812 Number of Sequences: 28952 Number of extensions: 338850 Number of successful extensions: 1040 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 914 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1040 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1487069504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -