BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30562.Seq (499 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q24407 Cluster: ATP synthase-coupling factor 6, mitocho... 56 6e-07 UniRef50_Q5MIP9 Cluster: Mitochondrial ATP synthase coupling fac... 53 3e-06 UniRef50_UPI00003C0C25 Cluster: PREDICTED: similar to ATPase cou... 50 4e-05 UniRef50_Q09JF4 Cluster: Mitochondrial F1F0 ATP-synthase subunit... 45 8e-04 UniRef50_UPI0000584DD8 Cluster: PREDICTED: similar to MGC68738 p... 44 0.002 UniRef50_A7SY16 Cluster: Predicted protein; n=1; Nematostella ve... 42 0.006 UniRef50_UPI00015605E4 Cluster: PREDICTED: similar to Neuroepith... 40 0.041 UniRef50_Q4QQ07 Cluster: IP06415p; n=2; Drosophila melanogaster|... 38 0.095 UniRef50_P18859 Cluster: ATP synthase-coupling factor 6, mitocho... 38 0.095 UniRef50_Q6NYF7 Cluster: ATP synthase, H+ transporting, mitochon... 37 0.29 UniRef50_Q29E93 Cluster: GA11349-PA; n=1; Drosophila pseudoobscu... 36 0.38 UniRef50_Q5DB31 Cluster: SJCHGC05665 protein; n=1; Schistosoma j... 36 0.67 UniRef50_UPI0000F1D396 Cluster: PREDICTED: similar to MGC68738 p... 34 2.0 UniRef50_Q7NRA0 Cluster: UDP-glucose 4-epimerase; n=1; Chromobac... 32 8.2 >UniRef50_Q24407 Cluster: ATP synthase-coupling factor 6, mitochondrial precursor; n=4; Endopterygota|Rep: ATP synthase-coupling factor 6, mitochondrial precursor - Drosophila melanogaster (Fruit fly) Length = 106 Score = 55.6 bits (128), Expect = 6e-07 Identities = 29/51 (56%), Positives = 35/51 (68%), Gaps = 2/51 (3%) Frame = -3 Query: 401 SKLVGLRAATTSMMVSRNLAAA--QKATDPIQQLFLDKIREYKQKSAGGKV 255 S L G+R T + + A KA+DPIQQLFLDK+REYKQKSAGGK+ Sbjct: 5 SLLSGMRVLRTEARRNFGIVAPALNKASDPIQQLFLDKVREYKQKSAGGKL 55 >UniRef50_Q5MIP9 Cluster: Mitochondrial ATP synthase coupling factor 6; n=3; Endopterygota|Rep: Mitochondrial ATP synthase coupling factor 6 - Aedes albopictus (Forest day mosquito) Length = 106 Score = 53.2 bits (122), Expect = 3e-06 Identities = 24/60 (40%), Positives = 35/60 (58%) Frame = -2 Query: 282 QTEERGWQSPDASPAVXXXXXXXXXXXXKQYGGGPGIDMTAFPSLKFEEPKLDPIDEQAA 103 +++ G + D +P + KQYGG G+DMTAFP+ KFEEPK+ PI+ +A Sbjct: 47 KSKSSGGKLVDPTPEIERELKQELEKLAKQYGGASGVDMTAFPTFKFEEPKMGPINSSSA 106 Score = 48.0 bits (109), Expect = 1e-04 Identities = 20/29 (68%), Positives = 26/29 (89%) Frame = -3 Query: 332 KATDPIQQLFLDKIREYKQKSAGGKVQMP 246 KATDPIQQLF++K+R+YK KS+GGK+ P Sbjct: 30 KATDPIQQLFVNKLRDYKSKSSGGKLVDP 58 >UniRef50_UPI00003C0C25 Cluster: PREDICTED: similar to ATPase coupling factor 6 CG4412-PA; n=2; Apocrita|Rep: PREDICTED: similar to ATPase coupling factor 6 CG4412-PA - Apis mellifera Length = 125 Score = 49.6 bits (113), Expect = 4e-05 Identities = 25/40 (62%), Positives = 31/40 (77%), Gaps = 4/40 (10%) Frame = -3 Query: 362 MVSRNLA----AAQKATDPIQQLFLDKIREYKQKSAGGKV 255 +V RN+ A Q+A DPIQ+LFLDKIREYK KS+GGK+ Sbjct: 43 IVKRNIGILAPAFQEAKDPIQKLFLDKIREYKAKSSGGKL 82 >UniRef50_Q09JF4 Cluster: Mitochondrial F1F0 ATP-synthase subunit Cf6; n=1; Argas monolakensis|Rep: Mitochondrial F1F0 ATP-synthase subunit Cf6 - Argas monolakensis Length = 109 Score = 45.2 bits (102), Expect = 8e-04 Identities = 19/45 (42%), Positives = 24/45 (53%) Frame = -2 Query: 252 DASPAVXXXXXXXXXXXXKQYGGGPGIDMTAFPSLKFEEPKLDPI 118 D +P + QYGGG GIDMT FP KF +P+LD + Sbjct: 60 DPNPVIMKEYEDDIKRAEVQYGGGKGIDMTKFPEFKFADPQLDSV 104 Score = 39.9 bits (89), Expect = 0.031 Identities = 16/22 (72%), Positives = 20/22 (90%) Frame = -3 Query: 335 QKATDPIQQLFLDKIREYKQKS 270 QKA DP+Q+LF+DK+REY QKS Sbjct: 30 QKALDPVQKLFVDKLREYTQKS 51 >UniRef50_UPI0000584DD8 Cluster: PREDICTED: similar to MGC68738 protein; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to MGC68738 protein - Strongylocentrotus purpuratus Length = 112 Score = 44.0 bits (99), Expect = 0.002 Identities = 22/40 (55%), Positives = 29/40 (72%), Gaps = 2/40 (5%) Frame = -3 Query: 368 SMMVSRNLAAAQKATDPIQQLFLDKIREY--KQKSAGGKV 255 S +V AA TDP+Q+LF+DKIR+Y K+KSAGGK+ Sbjct: 27 SSVVMAKTKAAAGPTDPVQKLFVDKIRDYSNKKKSAGGKL 66 >UniRef50_A7SY16 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 102 Score = 42.3 bits (95), Expect = 0.006 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 7/56 (12%) Frame = -3 Query: 401 SKLVGLRAATTSMMVSRNL-------AAAQKATDPIQQLFLDKIREYKQKSAGGKV 255 S+L +T S+++ RN+ A K DPIQ+LF++K+ YKQKS GGK+ Sbjct: 8 SRLAVASPSTCSIVLRRNIGTTYAAMAKMDKNADPIQRLFVEKLEAYKQKSKGGKL 63 >UniRef50_UPI00015605E4 Cluster: PREDICTED: similar to Neuroepithelial cell transforming gene 1; n=1; Equus caballus|Rep: PREDICTED: similar to Neuroepithelial cell transforming gene 1 - Equus caballus Length = 107 Score = 39.5 bits (88), Expect = 0.041 Identities = 23/55 (41%), Positives = 36/55 (65%), Gaps = 5/55 (9%) Frame = -3 Query: 398 KLVGLRAATTSMMVSRNL---AAAQKATDPIQQLFLDKIREY--KQKSAGGKVQM 249 +L + + S+ + RN+ A A K DPIQ+LF+DKIREY K++++GG V + Sbjct: 8 RLSSVVQSAISVHLRRNIGVTAVAFKELDPIQKLFVDKIREYRTKRQTSGGPVDI 62 >UniRef50_Q4QQ07 Cluster: IP06415p; n=2; Drosophila melanogaster|Rep: IP06415p - Drosophila melanogaster (Fruit fly) Length = 159 Score = 38.3 bits (85), Expect = 0.095 Identities = 18/39 (46%), Positives = 29/39 (74%), Gaps = 2/39 (5%) Frame = -3 Query: 368 SMMVSRNLA--AAQKATDPIQQLFLDKIREYKQKSAGGK 258 S+++ R+++ A+ + DPI Q+FLDK+REY+ KS GK Sbjct: 21 SLVLCRSVSNTASLRYKDPIYQIFLDKVREYRLKSPKGK 59 Score = 37.9 bits (84), Expect = 0.13 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = -2 Query: 195 QYGGGPGIDMTAFPSLKFEEPKLDPIDEQAAPK 97 QYGGG G+DM FP K + +DPI P+ Sbjct: 81 QYGGGEGVDMLEFPKFKLPDIDIDPISVDDLPE 113 >UniRef50_P18859 Cluster: ATP synthase-coupling factor 6, mitochondrial precursor; n=27; Tetrapoda|Rep: ATP synthase-coupling factor 6, mitochondrial precursor - Homo sapiens (Human) Length = 108 Score = 38.3 bits (85), Expect = 0.095 Identities = 19/31 (61%), Positives = 23/31 (74%), Gaps = 2/31 (6%) Frame = -3 Query: 341 AAQKATDPIQQLFLDKIREYKQK--SAGGKV 255 A K DPIQ+LF+DKIREYK K ++GG V Sbjct: 31 AFNKELDPIQKLFVDKIREYKSKRQTSGGPV 61 >UniRef50_Q6NYF7 Cluster: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F6; n=6; Euteleostomi|Rep: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F6 - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 112 Score = 36.7 bits (81), Expect = 0.29 Identities = 18/28 (64%), Positives = 22/28 (78%), Gaps = 2/28 (7%) Frame = -3 Query: 332 KATDPIQQLFLDKIREY--KQKSAGGKV 255 K DPIQ+LFLDKIR+Y K K++GG V Sbjct: 37 KDMDPIQKLFLDKIRDYNSKSKASGGVV 64 >UniRef50_Q29E93 Cluster: GA11349-PA; n=1; Drosophila pseudoobscura|Rep: GA11349-PA - Drosophila pseudoobscura (Fruit fly) Length = 180 Score = 36.3 bits (80), Expect = 0.38 Identities = 17/45 (37%), Positives = 20/45 (44%) Frame = -2 Query: 252 DASPAVXXXXXXXXXXXXKQYGGGPGIDMTAFPSLKFEEPKLDPI 118 DA P +YGGG G+DM FP K E LDP+ Sbjct: 51 DAGPEFEKELNETLEKLALKYGGGEGVDMLEFPKFKEPEVTLDPL 95 Score = 35.1 bits (77), Expect = 0.88 Identities = 16/39 (41%), Positives = 27/39 (69%), Gaps = 2/39 (5%) Frame = -3 Query: 368 SMMVSRNLA--AAQKATDPIQQLFLDKIREYKQKSAGGK 258 S+ R++A A ++ DPI ++FL K++EY++KS GK Sbjct: 10 SLFCRRSIAVSAERRYKDPIYEIFLAKVKEYREKSPTGK 48 >UniRef50_Q5DB31 Cluster: SJCHGC05665 protein; n=1; Schistosoma japonicum|Rep: SJCHGC05665 protein - Schistosoma japonicum (Blood fluke) Length = 126 Score = 35.5 bits (78), Expect = 0.67 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = -3 Query: 344 AAAQKATDPIQQLFLDKIREYKQKSAGGKV 255 A A + DPIQ F+ K+REY+QKS +V Sbjct: 28 AGASRVKDPIQLAFISKLREYRQKSEKSEV 57 >UniRef50_UPI0000F1D396 Cluster: PREDICTED: similar to MGC68738 protein; n=1; Danio rerio|Rep: PREDICTED: similar to MGC68738 protein - Danio rerio Length = 448 Score = 33.9 bits (74), Expect = 2.0 Identities = 19/41 (46%), Positives = 24/41 (58%), Gaps = 5/41 (12%) Frame = -3 Query: 377 ATTSMMVSRNLAAA-----QKATDPIQQLFLDKIREYKQKS 270 A T ++V N A ++ DPIQ+LFL KIREY KS Sbjct: 311 AQTDILVEENQTEAAEMLPEEQLDPIQRLFLHKIREYSTKS 351 >UniRef50_Q7NRA0 Cluster: UDP-glucose 4-epimerase; n=1; Chromobacterium violaceum|Rep: UDP-glucose 4-epimerase - Chromobacterium violaceum Length = 326 Score = 31.9 bits (69), Expect = 8.2 Identities = 20/52 (38%), Positives = 27/52 (51%) Frame = +3 Query: 186 LHTASQAFLIQFSALSRQQGWHLDFATRALLFVFPDFI*KQLLDGIGSFLSC 341 L A +A +A +RQ GWHL A R FV P F+ + IG+F+ C Sbjct: 157 LGQAKRAAEFLCAAYARQYGWHLS-AARCFAFVGP-FMPLDIHYAIGNFIQC 206 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 453,144,394 Number of Sequences: 1657284 Number of extensions: 8425279 Number of successful extensions: 15098 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 14862 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15096 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 29273652170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -