BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30561.Seq (748 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58517| Best HMM Match : Ribosomal_L30_N (HMM E-Value=1.5e-32) 93 2e-19 SB_59006| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_50714| Best HMM Match : TPR_2 (HMM E-Value=2.9e-15) 29 4.0 SB_32431| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_32430| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_12544| Best HMM Match : DUF1218 (HMM E-Value=2.7) 28 7.0 SB_8804| Best HMM Match : RGS (HMM E-Value=1.5e-37) 28 9.2 >SB_58517| Best HMM Match : Ribosomal_L30_N (HMM E-Value=1.5e-32) Length = 245 Score = 93.5 bits (222), Expect = 2e-19 Identities = 44/69 (63%), Positives = 53/69 (76%) Frame = +3 Query: 243 HQEEREIFKRAEQYVKEYRIKERDEIRLARQARNRGNYYVPGEAKLAFVIRIRGINQVSP 422 H + +EIFKRAE+YVKEYR KE DE+R+ + A+ GN+YVP EA+LAFVIRIRGIN VSP Sbjct: 41 HGKRKEIFKRAEKYVKEYRQKEVDELRMKKMAKKHGNFYVPPEARLAFVIRIRGINGVSP 100 Query: 423 KSVKFCNCL 449 K K L Sbjct: 101 KVRKILQLL 109 Score = 81.4 bits (192), Expect = 7e-16 Identities = 52/107 (48%), Positives = 62/107 (57%), Gaps = 1/107 (0%) Frame = +2 Query: 422 EVRKVLQLFRLRQINNGVFVRLNKATVNMYVSPSLTLLGDTPT*RVSVS*YTNVDSPS*V 601 +VRK+LQL RLRQINNGVFVRLNKAT NM + P + SV V Sbjct: 101 KVRKILQLLRLRQINNGVFVRLNKATANMLRIVQPYIAFGYPNLK-SVRELIYKRGYGKV 159 Query: 602 DXVYQSL-PTALLRRGSIKHNIICVXDLIHEIFTVWRKVQYASNFLW 739 D +L +++ + KH IICV DLIHEIFTV + ASNFLW Sbjct: 160 DKQRVALTDNSIVEKVLGKHGIICVEDLIHEIFTVGEHFKEASNFLW 206 Score = 72.5 bits (170), Expect = 3e-13 Identities = 32/49 (65%), Positives = 40/49 (81%) Frame = +1 Query: 508 VRIAEPYIAWGYPNLKSVRELVYKRGFAKLSGXRIPITSNSIVEKRLHK 654 +RI +PYIA+GYPNLKSVREL+YKRG+ K+ R+ +T NSIVEK L K Sbjct: 130 LRIVQPYIAFGYPNLKSVRELIYKRGYGKVDKQRVALTDNSIVEKVLGK 178 >SB_59006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1211 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = +1 Query: 328 PDKHAIVATTTFPGKPNWHLSSESVVSTKFHRSP*SSATV*TAPNK 465 PDK A+ TTT P + ++ T + R P S T+ T P K Sbjct: 363 PDKTAVPKTTTAPETTDASKTTVETQQTTYSRDPEISVTISTQPKK 408 >SB_50714| Best HMM Match : TPR_2 (HMM E-Value=2.9e-15) Length = 458 Score = 29.1 bits (62), Expect = 4.0 Identities = 22/72 (30%), Positives = 36/72 (50%) Frame = +1 Query: 232 RSSAIKKKGKSSRGLNSTSRNTASRNVMKSD*PDKHAIVATTTFPGKPNWHLSSESVVST 411 +++A K ++ G + TSR+T S K A T + +P+W L+S + VS Sbjct: 155 KTTASIKNVPTTNGPSKTSRSTDGEESAGSTHTKKPAKDDTDSSADEPDWDLTS-AFVSR 213 Query: 412 KFHRSP*SSATV 447 R+P S+ TV Sbjct: 214 AAGRNPTSTTTV 225 >SB_32431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 322 Score = 29.1 bits (62), Expect = 4.0 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -2 Query: 720 Y*TFLQTVKISWMRSSTQIMLCFMEPLLNNAVGSDWY 610 Y TF V + W + TQ ++ + N AVG +WY Sbjct: 276 YNTFYYEVLLPWNTALTQELVVKVTSSYNTAVGQNWY 312 >SB_32430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 29.1 bits (62), Expect = 4.0 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -2 Query: 720 Y*TFLQTVKISWMRSSTQIMLCFMEPLLNNAVGSDWY 610 Y TF V + W + TQ ++ + N AVG +WY Sbjct: 291 YNTFYYEVLLPWNTALTQELVVKVTSSYNTAVGQNWY 327 >SB_12544| Best HMM Match : DUF1218 (HMM E-Value=2.7) Length = 290 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -1 Query: 550 SWGIPKQCKARRYVHIHSSLIQTYKHTIVY 461 S IP++C+ +HIH L+ KH Y Sbjct: 115 SESIPEECEEAPPLHIHDLLLSLQKHLFAY 144 >SB_8804| Best HMM Match : RGS (HMM E-Value=1.5e-37) Length = 712 Score = 27.9 bits (59), Expect = 9.2 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +3 Query: 303 KERDEIRLARQARNRGNYYVP 365 K RD +AR+ R+RG YY+P Sbjct: 483 KIRDTSSIARETRSRGPYYLP 503 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,951,550 Number of Sequences: 59808 Number of extensions: 439911 Number of successful extensions: 1027 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 981 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1027 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2022185256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -