BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30559.Seq (708 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 27 0.58 AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CY... 24 5.4 AF004916-1|AAB94672.1| 686|Anopheles gambiae pro-phenol oxidase... 23 7.1 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 27.1 bits (57), Expect = 0.58 Identities = 16/51 (31%), Positives = 25/51 (49%) Frame = +3 Query: 189 RGSSH*EITGYAKEAFFCHQEEREIFKRAEQYVKEYRIKERDEIRLARQAR 341 R +SH + ++ QEER + AE+ + IKER++ RQ R Sbjct: 357 RDNSHQLVDALERQRAALAQEERNQARAAEEKDRIASIKEREQTEQQRQLR 407 >AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CYP9L1 protein protein. Length = 533 Score = 23.8 bits (49), Expect = 5.4 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +3 Query: 258 EIFKRAEQYVKEYRIKERDEIRLARQARNRGNYYVPGEAK 377 E+F+++ Q +E+ I D I L QAR Y P E++ Sbjct: 255 EMFRQSVQEREEHGIVRPDLIHLLIQARKGQLRYQPQESE 294 >AF004916-1|AAB94672.1| 686|Anopheles gambiae pro-phenol oxidase subunit 2 protein. Length = 686 Score = 23.4 bits (48), Expect = 7.1 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +3 Query: 390 IRIRGINQVSPKSVKFCNC 446 + + IN+ S + +FCNC Sbjct: 564 VALSNINEPSTEQFRFCNC 582 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 708,709 Number of Sequences: 2352 Number of extensions: 14380 Number of successful extensions: 14 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 72340815 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -