BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30547.Seq (748 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59790| Best HMM Match : VWA (HMM E-Value=0) 28 9.2 SB_28757| Best HMM Match : DUF1014 (HMM E-Value=4.9) 28 9.2 >SB_59790| Best HMM Match : VWA (HMM E-Value=0) Length = 4151 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +3 Query: 384 YLLNVRGGGKLIYRMTNPATTNAISRPTISSVNEIG 491 Y LNVR G + I R NP+ A RP + N G Sbjct: 468 YPLNVRYGARDISRSKNPSGRMANIRPAVGPDNRAG 503 >SB_28757| Best HMM Match : DUF1014 (HMM E-Value=4.9) Length = 434 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/58 (25%), Positives = 26/58 (44%) Frame = +3 Query: 420 YRMTNPATTNAISRPTISSVNEIGMRSCQVXXXXXXXXXXYLPLDPRKNPSLLIDLSN 593 +RM A +R T S NE ++ Q +LP PRK ++++ L++ Sbjct: 64 FRMLQKGKNEAKARTTPKSNNEKAYKTPQALGKAVDKVKHHLPKSPRKRNAVIVKLAS 121 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,354,944 Number of Sequences: 59808 Number of extensions: 439887 Number of successful extensions: 841 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 799 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 841 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2022185256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -