BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30545.Seq (748 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 23 3.0 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 22 7.0 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 21 9.3 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 21 9.3 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 23.0 bits (47), Expect = 3.0 Identities = 7/11 (63%), Positives = 10/11 (90%) Frame = -2 Query: 207 REPLFYLFNLV 175 R P+FY+FNL+ Sbjct: 211 RRPMFYVFNLI 221 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.8 bits (44), Expect = 7.0 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 539 KEGDAHNFMADMLTADAQT 595 K GD M D+LTA QT Sbjct: 28 KNGDYTKIMPDILTAIGQT 46 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 21.4 bits (43), Expect = 9.3 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -3 Query: 533 VTCRSRGNNLMAIRTSTECQIITYSTVETLAL 438 +T + GNN MA EC + + TL L Sbjct: 469 MTTVNEGNNNMAATYMNECLLNIQKSPRTLTL 500 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 21.4 bits (43), Expect = 9.3 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = +2 Query: 137 YENKSLEYIFNHQTKLNK*NNGSRFDESVLYKSEFAFTREVIELTR 274 YE ++ EYI+ K K NG V ++ A ++I TR Sbjct: 365 YERQNNEYIWIVSNKYQKIANGDLNFNEVNFRILNAPVNQLIRYTR 410 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,090 Number of Sequences: 438 Number of extensions: 4077 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23388480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -