BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= psV30543.Seq
(698 letters)
Database: rice
37,544 sequences; 14,793,348 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
09_02_0229 - 6062825-6064899,6064943-6065432,6065479-6065956,606... 29 3.5
>09_02_0229 - 6062825-6064899,6064943-6065432,6065479-6065956,
6066333-6066382,6068917-6069172,6069358-6069503
Length = 1164
Score = 29.1 bits (62), Expect = 3.5
Identities = 17/63 (26%), Positives = 26/63 (41%)
Frame = +1
Query: 88 VRPLQLGKVSLSFKKCCFQKLNTLFFVFYSQFKVPLLXXXXXXXXXXXXLPGHKIPKKIR 267
+R L L +KK F+++NT+ +F F P L LPG I +
Sbjct: 844 LRHLILSCTMPQYKKLSFEEINTIEAIFEGLFPPPSLEKLQIINFCGQSLPGWLISSSLE 903
Query: 268 PNI 276
N+
Sbjct: 904 TNL 906
Database: rice
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 14,793,348
Number of sequences in database: 37,544
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,332,432
Number of Sequences: 37544
Number of extensions: 207061
Number of successful extensions: 704
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 683
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 703
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1792053856
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -