BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30540.Seq (698 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC4G3.08 |psk1||serine/threonine protein kinase Psk1|Schizosac... 30 0.37 SPBC365.15 |alp4||gamma tubulin complex Spc97/GCP2 subunit Alp4|... 29 0.85 SPCC16A11.04 |snx12||sorting nexin Snx12 |Schizosaccharomyces po... 26 4.5 SPBC4F6.16c |ero11||ER oxidoreductin Ero1a|Schizosaccharomyces p... 26 4.5 SPBC902.02c |ctf18|chl12|DNA replication factor C complex subuni... 26 6.0 SPCC1442.05c |||conserved fungal protein|Schizosaccharomyces pom... 26 6.0 SPBC3D6.09 |dpb4||DNA polymerase epsilon subunit Dpb4 |Schizosac... 25 7.9 >SPCC4G3.08 |psk1||serine/threonine protein kinase Psk1|Schizosaccharomyces pombe|chr 3|||Manual Length = 436 Score = 29.9 bits (64), Expect = 0.37 Identities = 18/49 (36%), Positives = 24/49 (48%) Frame = +2 Query: 11 IVFYIILVVQARTLIP*INMADQNQQAGDTGPPKGIPALKAHIIANKID 157 I FY+ AR +I + Q+ G GP KG A+K H I +ID Sbjct: 308 IPFYV--TSDARDIINKFLKKNPKQRLGADGPEKGYDAIKKHRIYRRID 354 >SPBC365.15 |alp4||gamma tubulin complex Spc97/GCP2 subunit Alp4|Schizosaccharomyces pombe|chr 2|||Manual Length = 784 Score = 28.7 bits (61), Expect = 0.85 Identities = 21/54 (38%), Positives = 27/54 (50%) Frame = +3 Query: 312 DLPLAGFHGEVLPGGQRSLFILFTHFHERRAQFVNIGANLXICAATRRFVFLDY 473 DL + E+L G L I T F E R+ F N +CAA R+FV +DY Sbjct: 114 DLGIKDIASEMLEMGSHYLSI--TAFIESRSHFEYGFVNHALCAALRKFV-MDY 164 >SPCC16A11.04 |snx12||sorting nexin Snx12 |Schizosaccharomyces pombe|chr 3|||Manual Length = 1010 Score = 26.2 bits (55), Expect = 4.5 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = -2 Query: 250 FVECRHWIVKQWEHVSNGTQHGDYADPPKSYVY--FIGNDV 134 +VE R+ ++ EHV + Q+ DY++ S +Y F+ DV Sbjct: 493 WVEARNAMLMAQEHVFDIMQNSDYSEFVNSEIYYRFLAQDV 533 >SPBC4F6.16c |ero11||ER oxidoreductin Ero1a|Schizosaccharomyces pombe|chr 2|||Manual Length = 467 Score = 26.2 bits (55), Expect = 4.5 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = +1 Query: 316 SLSRDFMARFFLEDSAHYLFYSLIFMNVVPNLL 414 S S++ +A FF+ D YLFY+L F+ VP ++ Sbjct: 437 SPSKEILA-FFI-DQTWYLFYALFFICNVPRVI 467 >SPBC902.02c |ctf18|chl12|DNA replication factor C complex subunit Ctf18|Schizosaccharomyces pombe|chr 2|||Manual Length = 960 Score = 25.8 bits (54), Expect = 6.0 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +1 Query: 157 RSSLGGPRNHRAVYHWIR 210 R LG R HRA HWI+ Sbjct: 363 RDLLGDERVHRAAMHWIK 380 >SPCC1442.05c |||conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 177 Score = 25.8 bits (54), Expect = 6.0 Identities = 13/53 (24%), Positives = 25/53 (47%) Frame = +2 Query: 146 NKIDVALWGVRVITVLCTIGYVFPLFNNPVSAFYKAYSRTLRLQRCGYIKEFQ 304 N+I A W + ++ T + FP + + AF + +R QR +++ Q Sbjct: 94 NRIAPARWLITSLSTAATFMFCFPKTSKNIGAFVEKRFPAIRKQRMLVLEQTQ 146 >SPBC3D6.09 |dpb4||DNA polymerase epsilon subunit Dpb4 |Schizosaccharomyces pombe|chr 2|||Manual Length = 210 Score = 25.4 bits (53), Expect = 7.9 Identities = 14/53 (26%), Positives = 26/53 (49%) Frame = -3 Query: 618 PNXAXMSTXGNSTISASAAXPEDVPRLELDQGR*ADDHPQRILXKSIKDSQGI 460 PN + + + I A P D + EL++ R A+D Q + ++I D + + Sbjct: 111 PNVSDVDNRKKAKIDAHDTTPLDEEKDELEEERIAEDIAQNEVEQNIDDVEDL 163 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,638,445 Number of Sequences: 5004 Number of extensions: 53092 Number of successful extensions: 161 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 158 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 161 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -