BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30535.Seq (598 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ438610-6|CAD27478.1| 226|Anopheles gambiae hypothetical prote... 28 0.26 AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein pr... 28 0.26 AY341161-1|AAR13725.1| 159|Anopheles gambiae CED6 protein. 24 3.2 AY341160-1|AAR13724.1| 159|Anopheles gambiae CED6 protein. 24 3.2 AY341159-1|AAR13723.1| 159|Anopheles gambiae CED6 protein. 24 3.2 AY341158-1|AAR13722.1| 159|Anopheles gambiae CED6 protein. 24 3.2 AY341157-1|AAR13721.1| 159|Anopheles gambiae CED6 protein. 24 3.2 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 5.7 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 23 5.7 DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 pro... 23 9.9 AJ439060-9|CAD27760.1| 348|Anopheles gambiae putative translati... 23 9.9 >AJ438610-6|CAD27478.1| 226|Anopheles gambiae hypothetical protein protein. Length = 226 Score = 27.9 bits (59), Expect = 0.26 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +3 Query: 261 KCIVFIRPTSENIALLSRELRDPKYGVYFIY 353 KC+ F RP S ALL+ E + Y + F + Sbjct: 158 KCVPFCRPFSGQTALLTPESQSANYALTFAF 188 >AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein protein. Length = 942 Score = 27.9 bits (59), Expect = 0.26 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +3 Query: 174 VQSIGNLTEGSLLIREDRQSC 236 ++ +G T G ++IRED QSC Sbjct: 849 MKDVGEKTTGPIVIREDNQSC 869 >AY341161-1|AAR13725.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 24.2 bits (50), Expect = 3.2 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -3 Query: 416 SXXXITFGQSFDVCLRNYITE 354 S +T GQ+FD+ R Y+++ Sbjct: 135 SDITLTIGQAFDLAYRRYVSD 155 >AY341160-1|AAR13724.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 24.2 bits (50), Expect = 3.2 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -3 Query: 416 SXXXITFGQSFDVCLRNYITE 354 S +T GQ+FD+ R Y+++ Sbjct: 135 SDITLTIGQAFDLAYRRYVSD 155 >AY341159-1|AAR13723.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 24.2 bits (50), Expect = 3.2 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -3 Query: 416 SXXXITFGQSFDVCLRNYITE 354 S +T GQ+FD+ R Y+++ Sbjct: 135 SDITLTIGQAFDLAYRRYVSD 155 >AY341158-1|AAR13722.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 24.2 bits (50), Expect = 3.2 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -3 Query: 416 SXXXITFGQSFDVCLRNYITE 354 S +T GQ+FD+ R Y+++ Sbjct: 135 SDITLTIGQAFDLAYRRYVSD 155 >AY341157-1|AAR13721.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 24.2 bits (50), Expect = 3.2 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -3 Query: 416 SXXXITFGQSFDVCLRNYITE 354 S +T GQ+FD+ R Y+++ Sbjct: 135 SDITLTIGQAFDLAYRRYVSD 155 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.4 bits (48), Expect = 5.7 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -1 Query: 370 ETTLLKYIK*TPYLGSLSSRDNRAMFSD 287 +TTL+ Y Y+GSL N + SD Sbjct: 836 QTTLMSYSSNNDYIGSLVQVKNALVSSD 863 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +3 Query: 483 IVGCLQGPGWNQQHLQRV 536 + G +Q P QQHLQ V Sbjct: 170 LTGLMQAPSQQQQHLQPV 187 >DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 protein. Length = 545 Score = 22.6 bits (46), Expect = 9.9 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 451 WLWTDTCSLSILLDASK 501 W+W + + LLD+SK Sbjct: 417 WMWVSSSAFERLLDSSK 433 >AJ439060-9|CAD27760.1| 348|Anopheles gambiae putative translation initiation factor protein. Length = 348 Score = 22.6 bits (46), Expect = 9.9 Identities = 8/24 (33%), Positives = 17/24 (70%) Frame = +3 Query: 252 EHMKCIVFIRPTSENIALLSRELR 323 EH++ +V RPT+ N+ L + +++ Sbjct: 80 EHLQYLVTSRPTAVNLKLAADDVK 103 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 602,661 Number of Sequences: 2352 Number of extensions: 12215 Number of successful extensions: 17 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -