BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30532.Seq (648 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. 22 3.8 AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical pro... 22 3.8 AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 22 5.0 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 8.7 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 8.7 >AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. Length = 253 Score = 22.2 bits (45), Expect = 3.8 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +2 Query: 392 PWYQPSFTEVRKVLQLFRLRQINNG 466 P QP+ R + R++Q+NNG Sbjct: 80 PQQQPASVARRNARERNRVKQVNNG 104 >AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical protein protein. Length = 102 Score = 22.2 bits (45), Expect = 3.8 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -2 Query: 593 LSLANPRLYTNSRTLF 546 LS A PRL N+RT+F Sbjct: 87 LSSAFPRLKRNARTIF 102 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 21.8 bits (44), Expect = 5.0 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +3 Query: 249 EGIFKRAEQYVKEYRIKERDEIRLARQARNRGNY 350 +G FKR + Y +E + ++ RNR Y Sbjct: 107 KGFFKRTVRKDLSYACREEKNCIIDKRQRNRCQY 140 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.0 bits (42), Expect = 8.7 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +2 Query: 125 KTVRSCLLYQSQCSSIVRGERLFALG 202 K V C L +S + + G R ALG Sbjct: 496 KVVAECTLKESAAINQILGRRWHALG 521 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.0 bits (42), Expect = 8.7 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +2 Query: 125 KTVRSCLLYQSQCSSIVRGERLFALG 202 K V C L +S + + G R ALG Sbjct: 388 KVVAECTLKESAAINQILGRRWHALG 413 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,167 Number of Sequences: 336 Number of extensions: 2861 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16656800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -