BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30526.Seq (499 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33661| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 5e-04 SB_2774| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.099 SB_36852| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.30 SB_29584| Best HMM Match : DUF1106 (HMM E-Value=8.6) 28 3.7 SB_47404| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_20447| Best HMM Match : zf-C4 (HMM E-Value=2.09999e-41) 28 4.9 SB_46040| Best HMM Match : PTN_MK_N (HMM E-Value=5.4) 27 8.6 SB_503| Best HMM Match : Y_phosphatase (HMM E-Value=0) 27 8.6 >SB_33661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 425 Score = 41.1 bits (92), Expect = 5e-04 Identities = 25/78 (32%), Positives = 36/78 (46%), Gaps = 1/78 (1%) Frame = +2 Query: 23 LFYFKLWTHTNVEMQILTELSATLLGTSDKGVVEVTNCFCVP-HKEHADQVEAELNYAMD 199 L K+ H E + LLG +E+TNCF P +K D+ + ++NY M+ Sbjct: 23 LTVLKIIKHCEEEGSSGDLVQGVLLGLIQDNRLEITNCFPFPSNKAGDDEDDDDVNYQME 82 Query: 200 VYELNRRVNSSESIVGWW 253 V R VN VGW+ Sbjct: 83 VMRRLRAVNIDHLHVGWY 100 >SB_2774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 322 Score = 33.5 bits (73), Expect = 0.099 Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 3/48 (6%) Frame = +2 Query: 92 LLGTSDKGVVEVTNCFCVPHKE-HADQVE--AELNYAMDVYELNRRVN 226 LLG+ KGV++V NCF VP E DQ + +Y ++Y + ++VN Sbjct: 41 LLGSRRKGVLDVANCFAVPFDEDDRDQNVWFLDHDYLENMYAMFKKVN 88 Score = 31.9 bits (69), Expect = 0.30 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 4 SVKVHPVVLFQIVDAYER--RNADSHRVIGHLIGHERQ 111 +V VHP+VL +VD + R + RV+G L+G R+ Sbjct: 10 TVVVHPIVLLSVVDHFNRMGKVGSQKRVVGVLLGSRRK 47 >SB_36852| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 31.9 bits (69), Expect = 0.30 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = +2 Query: 170 VEAELNYAMDVYELNRRVNSSESIVGWWGLAMK*PTTPLLYTSI 301 V EL YA +YEL+++ N +E IVG + + T +++ I Sbjct: 1 VAVELEYAKSMYELSQKANPNEQIVGCVKMGVPGKTEGTMFSQI 44 >SB_29584| Best HMM Match : DUF1106 (HMM E-Value=8.6) Length = 219 Score = 28.3 bits (60), Expect = 3.7 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = -3 Query: 239 YFQRN*LFCSARKHPSRN*VPLRLDRHVLCVARRSSWLLPPLLCRSCP 96 Y+ + CS + PSR +P R R + +R+ W++ +CR P Sbjct: 36 YYNYRHVRCSRSREPSR--IPKRFLRRIHNKSRKLRWVVYHRICRKIP 81 >SB_47404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 27.9 bits (59), Expect = 4.9 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = -3 Query: 239 YFQRN*LFCSARKHPSRN*VPLRLDRHVLCVARRSSWLLPPLLCRSCP 96 Y+ + CS + PSR +P R R + +R+ W++ +CR+ P Sbjct: 90 YYNYRHVRCSRSREPSR--IPKRFLRRLHNKSRKLRWVVYHRICRNIP 135 >SB_20447| Best HMM Match : zf-C4 (HMM E-Value=2.09999e-41) Length = 419 Score = 27.9 bits (59), Expect = 4.9 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 6 CEGPSCCFISNCGRIRTSKCRF 71 C G + CFI R R KCRF Sbjct: 78 CRGSNDCFIDKVHRNRCQKCRF 99 >SB_46040| Best HMM Match : PTN_MK_N (HMM E-Value=5.4) Length = 248 Score = 27.1 bits (57), Expect = 8.6 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = -3 Query: 182 VPLRLDRHVLCVARRSSWLLPPLLCRSCPIRWPITL*ESAF 60 +P R + C+A+++ +L C C ++W +TL + F Sbjct: 17 LPSRTRKERSCIAKQNGDVLLDFPCDVCGVQWSLTLRKHEF 57 >SB_503| Best HMM Match : Y_phosphatase (HMM E-Value=0) Length = 979 Score = 27.1 bits (57), Expect = 8.6 Identities = 15/48 (31%), Positives = 28/48 (58%), Gaps = 4/48 (8%) Frame = +2 Query: 116 VVEVTNCFCVPHKEHADQVEAELNYAMDVYELN----RRVNSSESIVG 247 ++ + +C + HKEHAD+ E++ A+ ++ LN R + + E VG Sbjct: 706 IIALNSCRVMLHKEHADE-ESDYINAVFLHRLNSFTSREIPAEEKSVG 752 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,229,335 Number of Sequences: 59808 Number of extensions: 333602 Number of successful extensions: 1023 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 983 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1022 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1075029208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -