BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30523.Seq (748 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44893| Best HMM Match : FGGY_C (HMM E-Value=2.5) 46 4e-05 SB_34143| Best HMM Match : FGGY_C (HMM E-Value=0.51) 46 4e-05 SB_17612| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_54008| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_42367| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_21449| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_45306| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_23698| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_39673| Best HMM Match : TRAP-delta (HMM E-Value=1.2e-32) 28 7.0 SB_29854| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_44786| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_16259| Best HMM Match : AAA (HMM E-Value=0.43) 28 9.2 SB_58863| Best HMM Match : Fibrinogen_BP (HMM E-Value=2) 28 9.2 SB_27151| Best HMM Match : Thioredoxin (HMM E-Value=9.2e-32) 28 9.2 >SB_44893| Best HMM Match : FGGY_C (HMM E-Value=2.5) Length = 85 Score = 45.6 bits (103), Expect = 4e-05 Identities = 23/38 (60%), Positives = 29/38 (76%), Gaps = 2/38 (5%) Frame = -3 Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA--MRVW 402 +Q+QAD+LGI V RP M E+TALGAA+ AG A + VW Sbjct: 25 MQLQADILGISVERPTMPETTALGAAMAAGAAKGIEVW 62 >SB_34143| Best HMM Match : FGGY_C (HMM E-Value=0.51) Length = 137 Score = 45.6 bits (103), Expect = 4e-05 Identities = 23/38 (60%), Positives = 29/38 (76%), Gaps = 2/38 (5%) Frame = -3 Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA--MRVW 402 +Q+QAD+LGI V RP M E+TALGAA+ AG A + VW Sbjct: 25 MQLQADILGISVERPTMPETTALGAAMAAGAAKGIEVW 62 >SB_17612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 566 Score = 45.6 bits (103), Expect = 4e-05 Identities = 23/38 (60%), Positives = 29/38 (76%), Gaps = 2/38 (5%) Frame = -3 Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA--MRVW 402 +Q+QAD+LGI V RP M E+TALGAA+ AG A + VW Sbjct: 436 MQLQADILGISVERPTMPETTALGAAMAAGAAKGIEVW 473 >SB_54008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1940 Score = 30.7 bits (66), Expect = 1.3 Identities = 22/84 (26%), Positives = 34/84 (40%), Gaps = 9/84 (10%) Frame = +1 Query: 403 HTRIARPATMAAPRAVLSIMRGRMTGIPSKSACICTELSS---------APSLRRRGVAS 555 H + P +A P ++S+ G ++G + + T S PS R + Sbjct: 1637 HPSMLMPHPLAMPGLMMSMSSGMISGSNTSTTTTATSSRSRDPDSSPYRTPSDRSSPLTV 1696 Query: 556 GARSLQPSRPPRRASGDTRPPARA 627 G RS +P PPR R P R+ Sbjct: 1697 GGRSSRPRSPPRLMEPRPRSPVRS 1720 >SB_42367| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 266 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -3 Query: 698 GEKDRPGEXCAVLSERTRRQHIVRARAGGRVSPDAR 591 GE + GE +LS+ R H R + GR PD R Sbjct: 40 GELNEEGEEGEILSDEETRDHQTRCGSRGREDPDVR 75 >SB_21449| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 29.5 bits (63), Expect = 3.0 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -3 Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVW 402 +++ + L G + RP + + LGAA +AG A VW Sbjct: 21 MELTSSLTGQSMDRPSQTDMSVLGAAFLAGMATGVW 56 >SB_45306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1576 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/71 (23%), Positives = 30/71 (42%) Frame = +1 Query: 472 MTGIPSKSACICTELSSAPSLRRRGVASGARSLQPSRPPRRASGDTRPPARALTIC*RRV 651 + GIP+ + + + AP + G+ A+ + P PP R A T+ + Sbjct: 227 LAGIPTHNTPTFKQAAKAPLINTLGINPQAKGIIPGHPPNMGPASGR-TAGMTTVAPKAQ 285 Query: 652 LSLKTAHXSPG 684 + A+ SPG Sbjct: 286 VDNHPANISPG 296 >SB_23698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 29.1 bits (62), Expect = 4.0 Identities = 12/23 (52%), Positives = 14/23 (60%), Gaps = 2/23 (8%) Frame = +3 Query: 363 QECIGRW--AGYCRGPHTHCATC 425 QEC+GRW A + RG H C C Sbjct: 26 QECLGRWNVAQFFRGRHPTCPHC 48 >SB_39673| Best HMM Match : TRAP-delta (HMM E-Value=1.2e-32) Length = 504 Score = 28.3 bits (60), Expect = 7.0 Identities = 30/103 (29%), Positives = 43/103 (41%), Gaps = 5/103 (4%) Frame = +1 Query: 409 RIARPATMAAPRAVLSIMRGRMTGIPSKSACICTELSSAP-SLRRRGVASGARSLQ-PSR 582 R ARP + R R + PS S+ E +L +R RS Q +R Sbjct: 395 RTARPPPRSNQRTARPPPRSKSENRPSSSSLAVREPPVLLLALSQRTARPPPRSNQRTAR 454 Query: 583 PPRRASGDTRPPARALTIC*RRVLSLKTAHXS---PGRSFSPN 702 PP R+ + RP + +L + VL L + + P RS S N Sbjct: 455 PPPRSKSENRPSSSSLAVREPPVLLLALSQRTARPPPRSKSEN 497 >SB_29854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3235 Score = 28.3 bits (60), Expect = 7.0 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +1 Query: 508 TELSSAPSLRRRGVASGARSLQPSRPP 588 T L++ PS R+ G +S A++ +PS PP Sbjct: 3156 TVLTTLPSSRQAGTSSTAKATRPSVPP 3182 >SB_44786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 824 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +3 Query: 606 HTASSAGPDNMLTSSPFAQNRTSLPWAVFFSQYGE 710 HT SS+ P + T TSLP A F Q+ E Sbjct: 181 HTRSSSYPGKITTGISHDSTATSLPKAPFLEQFSE 215 >SB_16259| Best HMM Match : AAA (HMM E-Value=0.43) Length = 538 Score = 27.9 bits (59), Expect = 9.2 Identities = 18/50 (36%), Positives = 23/50 (46%) Frame = -2 Query: 543 SPTEGWRRTQFCADAG*FTGYTSHSSPHDGKYSPGGGHCRRSRNACVAHD 394 SP G+R T F G T + +S H + S G RNACV+ D Sbjct: 484 SPYLGFRSTSF-TPLG--TAFAYMASVHTRRTSSRGNRLNMRRNACVSQD 530 >SB_58863| Best HMM Match : Fibrinogen_BP (HMM E-Value=2) Length = 1037 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +1 Query: 517 SSAPSLRRRGVASGARSLQPSRPPRRASGDTRPPARA 627 +S+ + RRR +A ARSL S P R G P R+ Sbjct: 632 ASSRAQRRRSLAHSARSLPGSMPSDRDLGRKNPQGRS 668 >SB_27151| Best HMM Match : Thioredoxin (HMM E-Value=9.2e-32) Length = 456 Score = 27.9 bits (59), Expect = 9.2 Identities = 17/60 (28%), Positives = 29/60 (48%) Frame = -1 Query: 502 CRLIYWVYQSFVPS*WKVQPWGRPLSQVAQCVCGPRQYPAHRPIHSCRLLPMKNEKCGEF 323 CR + +Q VP+ + Q WG + + +C +Q R H +LL + +CGE+ Sbjct: 290 CRQVAVYHQRGVPT-LEEQEWGVGVVEEYKCPTCSQQIRFPRYNHPAKLLETRCGRCGEW 348 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,986,616 Number of Sequences: 59808 Number of extensions: 553790 Number of successful extensions: 1472 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1317 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1465 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2022185256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -